DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2d and npc2.2

DIOPT Version :9

Sequence 1:NP_649975.1 Gene:Npc2d / 41232 FlyBaseID:FBgn0037782 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001122191.1 Gene:npc2.2 / 565099 ZFINID:ZDB-GENE-080723-11 Length:149 Species:Danio rerio


Alignment Length:161 Identity:40/161 - (24%)
Similarity:68/161 - (42%) Gaps:16/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEVKVLVLISLGLLLSLAEAQQEHPATSVK--KCSGSKPFPLEVRVHNCVTPPCQIVKGTTQKFE 63
            |:.:||.:|.|..|....       |..||  .|.......::|.:..|...|||:.||.:....
Zfish     1 MDYRVLAVILLSFLAYTC-------ADPVKFVDCGSVHGKVVQVDIKPCSQQPCQLHKGQSYTVN 58

  Fly    64 IDFAVDKYITQLTTLVKATTLGIITVPYELPADVAAVCPNLQYGAYCPLYPTEDVSYLFTFPI-G 127
            :.| :....:|.:..|....:..:.||:.:|.|     ...:.|..||:.|.:..:|:...|: .
Zfish    59 VTF-ISSVASQTSKAVVHGVVECVPVPFPIPID-----DGCKSGIQCPIVPQKPYNYVTELPVKT 117

  Fly   128 EYPEIGVKIEIYLVDQDNEIATCFVCDIKVV 158
            |||.|.|.:|..|.|..::...|....:::|
Zfish   118 EYPAIKVVVEWELRDDSSKDLFCIKFPVQIV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2dNP_649975.1 Npc2_like 29..155 CDD:238458 32/128 (25%)
npc2.2NP_001122191.1 Npc2_like 24..145 CDD:238458 30/126 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.