DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2d and npc2

DIOPT Version :9

Sequence 1:NP_649975.1 Gene:Npc2d / 41232 FlyBaseID:FBgn0037782 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_012823720.1 Gene:npc2 / 493351 XenbaseID:XB-GENE-6258064 Length:156 Species:Xenopus tropicalis


Alignment Length:152 Identity:36/152 - (23%)
Similarity:65/152 - (42%) Gaps:12/152 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLISLGLLLSLAEAQQEHPATSVKKCSGSKPFPLEVRVHNCVTPPCQIVKGTTQKFEIDFAVDKY 71
            ||:::.||.|......::     |.|.......:.:.|..|...||.:|:|:|......|..:..
 Frog    13 VLLTVFLLPSSVPEPLKY-----KDCGSQSGKLVTLDVSPCPEEPCPLVRGSTYTVNATFVSNVN 72

  Fly    72 ITQLTTLVKATTLGIITVPYELPADVAAVCPNLQYGAYCPLYPTEDVSYLFTFPI-GEYPEIGVK 135
            ....:.:|.....| |.||:  |......|.:   |..||:...:..:|:...|| .|||.|.:.
 Frog    73 SKSASAVVHGIIAG-IAVPF--PISEPDGCKS---GISCPINSGQTYTYVTKLPIKSEYPCIKLV 131

  Fly   136 IEIYLVDQDNEIATCFVCDIKV 157
            ::..|.|::|:...|::..:.:
 Frog   132 VKWQLQDENNKDLFCWLIPVHI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2dNP_649975.1 Npc2_like 29..155 CDD:238458 31/126 (25%)
npc2XP_012823720.1 Npc2_like 30..151 CDD:238458 31/131 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.