DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2d and Npc2g

DIOPT Version :9

Sequence 1:NP_649975.1 Gene:Npc2d / 41232 FlyBaseID:FBgn0037782 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001247375.1 Gene:Npc2g / 43648 FlyBaseID:FBgn0039800 Length:159 Species:Drosophila melanogaster


Alignment Length:172 Identity:48/172 - (27%)
Similarity:66/172 - (38%) Gaps:41/172 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLISLGLLLSLAEAQQ---EHPATSVKKCSGSKPFPLEVRVHNCV----TPPCQIVKGTTQKFEI 64
            |.|::.|:.|.|.|:.   |....||..|:..     :|||..|.    ...|.|.:....:...
  Fly    10 VAIAIVLISSSASAEVVNFEPCPDSVDTCTIQ-----QVRVSPCPEALNNAACNIRRKHNSEMSF 69

  Fly    65 DFAVDKYITQLTTLVKATTLG-----IITVPYELPADVAAV----CPNLQYG---AYCPLYPTED 117
            ||..:   ....|||  .:||     .:.:|. |..|.||.    || ::.|   .|..|.|.| 
  Fly    70 DFTPN---FDADTLV--ASLGWAKSENVELPL-LTLDSAACKYTPCP-VRSGVKQTYTTLVPIE- 126

  Fly   118 VSYLFTFPIGEYPEIGVKIEIYLVDQDNEIATCFVCDIKVVK 159
                ..||:..|     .|...|.|..::...||..|||||:
  Fly   127 ----AKFPLSPY-----TIRWALKDPVSQKRCCFTIDIKVVR 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2dNP_649975.1 Npc2_like 29..155 CDD:238458 35/141 (25%)
Npc2gNP_001247375.1 Npc2_like 28..155 CDD:238458 37/148 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6567
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.