DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2d and Npc2c

DIOPT Version :9

Sequence 1:NP_649975.1 Gene:Npc2d / 41232 FlyBaseID:FBgn0037782 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_649976.1 Gene:Npc2c / 41233 FlyBaseID:FBgn0037783 Length:165 Species:Drosophila melanogaster


Alignment Length:156 Identity:59/156 - (37%)
Similarity:91/156 - (58%) Gaps:7/156 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISLGLLLSLAEAQQEHPATSVKKCSGSK-PFPLEVRVHNCVTPPCQIVKGTTQKFEIDF-AVDKY 71
            :||.|:||:...... .:|.:::|:.|. |.||.|::.:|...||.:.|||..|.:|.| |....
  Fly     7 LSLCLVLSIMWTSVA-DSTPIRQCADSNYPQPLMVQIDDCDALPCDLWKGTEAKIDIQFVATRNT 70

  Fly    72 ITQLTTLVKATTLGIITVPYELPADVAAVCPNLQYGAYCPLYPTEDVSYLFTFPI-GEYPEIGVK 135
            :.:|:..|..|:|| :|:||:|.|....||.||.:||||||...|||:|....|: ...||:..:
  Fly    71 MKKLSAEVHLTSLG-VTIPYDLEASRGNVCSNLLHGAYCPLDAGEDVTYQLLLPVTTNQPEVPTR 134

  Fly   136 IEIYLVDQD--NEIATCFVCDIKVVK 159
            :|:.|:|.|  |.:.:||:.|.:|.|
  Fly   135 LEVRLLDSDDENRVVSCFLADTRVKK 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2dNP_649975.1 Npc2_like 29..155 CDD:238458 50/130 (38%)
Npc2cNP_649976.1 Npc2_like 26..155 CDD:238458 50/129 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469002
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25884
OrthoDB 1 1.010 - - D110250at33392
OrthoFinder 1 1.000 - - FOG0003275
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.