DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2d and heh-1

DIOPT Version :9

Sequence 1:NP_649975.1 Gene:Npc2d / 41232 FlyBaseID:FBgn0037782 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001379800.1 Gene:heh-1 / 175426 WormBaseID:WBGene00006452 Length:154 Species:Caenorhabditis elegans


Alignment Length:166 Identity:41/166 - (24%)
Similarity:64/166 - (38%) Gaps:25/166 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VKVLVLISLGLLLSLAEAQQEHPATSVKKCSGSKPFPLEVRVHNCV------TPPCQIVKGTTQK 61
            :|.::.::   ||.||.|:.......|.|..|:..   :|:...|.      ...|...||:...
 Worm     1 MKTVIFLA---LLGLAAAEFIEIGYKVCKSDGTVS---QVKADGCELTVKDGKKVCLFKKGSRPI 59

  Fly    62 FEIDFAVDKYITQLTTLVKATTLGIITVPYELPADVAAVCPNLQYGAYCPLYPTED------VSY 120
            .:|.|...|...:|.|.|:|...|...|  :.|...:..|   .||..||:...|:      :|.
 Worm    60 IQIAFKPSKDTDKLKTSVRAKVGGSAMV--DFPQTNSDAC---TYGVKCPVSAGENQIFEQSISI 119

  Fly   121 LFTFPIGEYPEIGVKIEIYLVDQDNEIATCFVCDIK 156
            ....|.||.  |.|..::...|...|:...|:.:||
 Worm   120 TENHPAGEV--IQVNWQLTRPDSGKEVCIIFLAEIK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2dNP_649975.1 Npc2_like 29..155 CDD:238458 33/137 (24%)
heh-1NP_001379800.1 Npc2_like 22..150 CDD:238458 33/137 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.