DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fancl and AT5G65740

DIOPT Version :9

Sequence 1:NP_649974.1 Gene:Fancl / 41231 FlyBaseID:FBgn0037781 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001032152.1 Gene:AT5G65740 / 836703 AraportID:AT5G65740 Length:300 Species:Arabidopsis thaliana


Alignment Length:305 Identity:71/305 - (23%)
Similarity:123/305 - (40%) Gaps:62/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VPKELCREGNIYYDILALYKSNEYCLQVDEACSMIRF-------SEFTDFEQHYLELK-----IP 153
            |.:|.|.|         |.||:.:..:|......|.:       .:.|.|..|.|:.|     :.
plant     9 VGRERCEE---------LAKSSSFYRKVYSEIEEIGWEPIRRLGGDLTFFSFHILDKKGRAHNLE 64

  Fly   154 SLLLLDH-SLPDCVS--LGEMLT---KSAGNLEEALNLFRKLLEDLRPFYDNFMDIDE-LCHVLQ 211
            ..|..|: :.|..||  :..|.|   .::..|::.::.|:|.|:.|:.|:....:||: ||.|..
plant    65 IQLNRDYPNSPPSVSADVPYMFTLEWSTSSRLKDVMHQFQKHLDYLQEFWSVLDNIDKSLCVVDV 129

  Fly   212 PSPISSKHKTRLFPLKDRVYL-KLTIADPFACIASMSLKIIGPTEEVARLR--HVL-SDGLSNWD 272
            ..|..:....|:....|.:.: .:...||.:...|   :.|||......:.  |:| ......|.
plant   130 KQPARASAIRRIDAGNDCIIIVHIDFKDPKSLPES---RFIGPVPSATHMNNLHMLWRRNCKRWS 191

  Fly   273 SEMNIHKNLLRMFDLCYFPMPDWSDGPKLD-------EEDNEELRCNICFAYRLD--------GG 322
            :|.:..:||     .|..       |.:|.       |:|.:::.|.||:|..|.        .|
plant   192 NERSFPENL-----ECIL-------GTELPKPLGLQVEDDQQQVECGICYAQFLPTDEELGARSG 244

  Fly   323 EVPLVSCDNAKCVLKCHAVCLEEWFKTLMDGKTFLEVSFGQCPFC 367
            .....:|:|..|....|::||.:|.:::...:...:|.||.||:|
plant   245 TRTDYTCENISCNKSFHSLCLTDWLRSITTTRQSFDVLFGNCPYC 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FanclNP_649974.1 WD-3 20..293 CDD:286806 48/214 (22%)
FANCL_C 307..376 CDD:288626 19/69 (28%)
AT5G65740NP_001032152.1 FANCL_d2 23..110 CDD:408660 18/86 (21%)
FANCL_d3 112..211 CDD:408661 24/113 (21%)
FANCL_C 221..298 CDD:403100 19/69 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4652
eggNOG 1 0.900 - - E1_KOG3268
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2561
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1002812at2759
OrthoFinder 1 1.000 - - FOG0007502
OrthoInspector 1 1.000 - - oto3140
orthoMCL 1 0.900 - - OOG6_105411
Panther 1 1.100 - - LDO PTHR13206
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.