DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fancl and Y105C5B.11

DIOPT Version :9

Sequence 1:NP_649974.1 Gene:Fancl / 41231 FlyBaseID:FBgn0037781 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001263827.1 Gene:Y105C5B.11 / 190893 WormBaseID:WBGene00013651 Length:772 Species:Caenorhabditis elegans


Alignment Length:267 Identity:49/267 - (18%)
Similarity:91/267 - (34%) Gaps:97/267 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ESLEYKLYTSANLKLQDDWLLEDFLDHLPKILPAQKAPTVPKELCREGNIY-------YDILALY 119
            ||.|||              .:|.:.:..|:|.::|.      :|.:|.:.       ..:::||
 Worm    55 ESKEYK--------------RKDVVLYREKLLISEKL------ICLDGQVLTVSCAVAAMLVSLY 99

  Fly   120 KSNEYCLQVDEACSMIR---FSEFTDFEQHYLELK--------IPSLLLLD----------HSLP 163
            .........|:..|.:|   ..:..::...||.:|        :..|:.:|          |.||
 Worm   100 VERHQHKLTDKQISKLRKYMMLKNIEYRPFYLNIKDMRWIYDNVDFLMNIDKDTLRPLDNRHQLP 164

  Fly   164 DCVSLGEMLTKSAGNLEEALNLFRKLLEDL--------RPFYDNFMDIDELCHVLQPSPISSKHK 220
            :...|.|:         ..|:::.:.:...        |.|.::.:||..:....|.:||:...|
 Worm   165 NITELAEL---------HQLDVYLRTVTSTLINPDAHRRIFVEDLLDIIPILLKQQGNPINEAGK 220

  Fly   221 TRLFPLKDRVYL---------------------------KLTIADPFACIASMSLKIIGPTEEVA 258
            .::  .|.||.|                           |||:|.....:.|....::.|.::..
 Worm   221 QKI--RKYRVELQGDIAGHSTVDLKKLDEILDDFDVDKTKLTLAPEVTNLVSREQMMMHPRDQYL 283

  Fly   259 RLRHVLS 265
               ||||
 Worm   284 ---HVLS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FanclNP_649974.1 WD-3 20..293 CDD:286806 49/267 (18%)
FANCL_C 307..376 CDD:288626
Y105C5B.11NP_001263827.1 OmpH 610..>678 CDD:377167
RING_Ubox 716..758 CDD:388418
RING-H2 finger (C3H2C3-type) 717..758 CDD:319361
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D411664at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.