DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ohgt and si:ch211-51h9.7

DIOPT Version :9

Sequence 1:NP_649973.1 Gene:ohgt / 41230 FlyBaseID:FBgn0037780 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001121712.1 Gene:si:ch211-51h9.7 / 558400 ZFINID:ZDB-GENE-081104-235 Length:166 Species:Danio rerio


Alignment Length:103 Identity:33/103 - (32%)
Similarity:44/103 - (42%) Gaps:24/103 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 LFFCRYCNSSLALCSDL------FAMSKHG--------VQTQ-YCNPEGYIHETNTVYR--VISH 499
            |..||.|...||..:||      .|:|...        |..| :.||.|:..|..|..|  |:.|
Zfish    24 LLLCRSCGHELAEDTDLSFVPSRMALSHRNDTVIGGKRVSVQLFENPHGFQFEVVTFRRADVLKH 88

  Fly   500 AIGYSGEPSTK-FSWFPGYQWHIILCKFCAQHVGWEFK 536
                  .|:.: |||:||:.|....|..|..|:||.|:
Zfish    89 ------WPADRHFSWYPGHSWTAATCPRCKTHLGWAFQ 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ohgtNP_649973.1 PHA02664 <35..109 CDD:177447
CRBN_C_like 453..555 CDD:276940 32/102 (31%)
si:ch211-51h9.7NP_001121712.1 CRBN_C_like 25..148 CDD:276940 32/102 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1069900at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3865
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.