DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtTFB2 and PFC1

DIOPT Version :9

Sequence 1:NP_649971.1 Gene:mtTFB2 / 41228 FlyBaseID:FBgn0037778 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001322240.1 Gene:PFC1 / 839283 AraportID:AT1G01860 Length:346 Species:Arabidopsis thaliana


Alignment Length:264 Identity:64/264 - (24%)
Similarity:105/264 - (39%) Gaps:57/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CSWSFARANYSTKKELVTRYSGDFPEKLLNRKQKVPTHMYIANSEAAARINQYLEPHFQSSGCDT 70
            |..|.....:||.|.|.:|  |.||.|.|.:.       |:.||:    ||..|.........|.
plant    49 CGKSSPDDYHSTLKSLNSR--GRFPRKSLGQH-------YMLNSD----INDQLASAADVKEGDF 100

  Fly    71 VMELNSGAGYFTRHLLDRESQFRRIILLESMDHFMPKIQELHTLYPERVKVRQGDFVNLW----- 130
            |:|:..|.|..|..|::..:   .::.:|...|.:..:.| .....::.||.|.|||...     
plant   101 VLEIGPGTGSLTNVLINLGA---TVLAIEKDPHMVDLVSE-RFAGSDKFKVLQEDFVKCHIRSHM 161

  Fly   131 -------KLVYMDKMDGGSRVADLLSDVPQKAFTDDINMLVFGAVGSYPFFKHLINSLIFQTSLF 188
                   :|.:.|     |.:|.::|::|....||.:.:|:  .:|.  .|..::  |:.|.   
plant   162 LSILETRRLSHPD-----SALAKVVSNLPFNISTDVVKLLL--PMGD--IFSKVV--LLLQD--- 212

  Fly   189 NLGRCEMILAMPPPIYIHLTCNNEIGYLIYRSTSVLFQILFEHKFIAKVPREDFLPQQMAYSPTK 253
                 |..|.:..|.   |..:.      ||..::|.....|.::..:||||:|.||....:...
plant   213 -----EAALRLVEPA---LRTSE------YRPINILINFYSEPEYNFRVPRENFFPQPKVDAAVV 263

  Fly   254 SSKL 257
            :.||
plant   264 TFKL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtTFB2NP_649971.1 AdoMet_MTases 69..309 CDD:302624 46/201 (23%)
PFC1NP_001322240.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11727
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.