DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtTFB2 and tfb2m

DIOPT Version :9

Sequence 1:NP_649971.1 Gene:mtTFB2 / 41228 FlyBaseID:FBgn0037778 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001107089.2 Gene:tfb2m / 569468 ZFINID:ZDB-GENE-070521-3 Length:437 Species:Danio rerio


Alignment Length:352 Identity:96/352 - (27%)
Similarity:155/352 - (44%) Gaps:47/352 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RYS----GDFPEKLLNRKQKVPTHM--YIANSEAAARINQYLEPHFQSSGCDTVMELNSGAGYFT 82
            ||.    ||..|.  .:|..|..::  :|.:...|..:..:|.... ..|...:.|.|.|.|..|
Zfish    87 RYDPLDLGDVDEN--EQKALVCKNLRRFIVDPALATIVTDHLSRDI-DDGKAVIFECNPGPGVLT 148

  Fly    83 RHLLDRESQFRRIILLESMDHFMPKIQELHTLYPERVKVRQGDFVNLWKL---------VYMDKM 138
            |.||:|.:|  |::.|||..:|:|::.||.:....::.|...||..|..:         :|.:|:
Zfish   149 RALLNRGAQ--RVVALESDANFLPELLELESRLEGQLDVVHCDFFKLDPIGNGIMKPPVMYSEKL 211

  Fly   139 DGGSRVADL-LSDVPQKAFTDDINMLVFGAV---GSYPFFKHLINSLIFQTSLFNLGRCEMILAM 199
                 .:|| :|:||   :|.|:.:.:.|..   ........:|.:|..:.|:|..||.|:|:.:
Zfish   212 -----FSDLAISEVP---WTADVPVKIVGLFTQRNERNLMWKMIYNLFERRSIFRYGRVELIMFI 268

  Fly   200 PPPIYIHLTCNNEIGYLIYRSTSVLFQILFEHKFIAKVPREDFLPQQMAYSPTKSSKLGKVQSIN 264
            ....|..|..... .|..|::.|.|.|:.|:.:.:.:.|...||   ...:..:.|..|...| .
Zfish   269 SQKEYTKLVTRPR-DYKNYQAFSALAQMAFDIELLHEEPLSSFL---TTTNNNRKSASGSTLS-Q 328

  Fly   265 PEYLYLVKFTPRRNLHELCQSQDLP----ALWFFIKQNYVSRRNRIIPNLEKWVPGCGPRLIIN- 324
            .|.|.||:.|||   .:|..|...|    .|...:||....|:.::|..:..|.||.|..||.| 
Zfish   329 SENLCLVRITPR---EDLFSSHLTPLNGSTLVLMVKQCLAKRKGKLIQQINSWSPGMGSELISNL 390

  Fly   325 PKSSESVT-PIYPDELPKKLPQYSCQS 350
            ....:::| .:||||. |:|.:...||
Zfish   391 GFLDDTLTGDVYPDEY-KRLFELMEQS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtTFB2NP_649971.1 AdoMet_MTases 69..309 CDD:302624 69/256 (27%)
tfb2mNP_001107089.2 P-loop_NTPase 41..>113 CDD:304359 7/27 (26%)
AdoMet_MTases 112..415 CDD:302624 87/322 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11271
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5221
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1169941at2759
OrthoFinder 1 1.000 - - FOG0007855
OrthoInspector 1 1.000 - - oto39545
orthoMCL 1 0.900 - - OOG6_108981
Panther 1 1.100 - - LDO PTHR11727
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6953
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.960

Return to query results.
Submit another query.