DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtTFB2 and CG11837

DIOPT Version :9

Sequence 1:NP_649971.1 Gene:mtTFB2 / 41228 FlyBaseID:FBgn0037778 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_651660.1 Gene:CG11837 / 43429 FlyBaseID:FBgn0039627 Length:306 Species:Drosophila melanogaster


Alignment Length:311 Identity:61/311 - (19%)
Similarity:121/311 - (38%) Gaps:75/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ARANYSTKKELVTRYSGDFPEKLLNRKQKVPTHMYIANSEAAARINQYLEPHFQSSGCDTVMELN 75
            :|.:...:|:.:. ::.||.:.:|.....:.|.:    .:||.|            ..|.|:|:.
  Fly    10 SRIHNDVQKQGIV-FNKDFGQHILKNPLVITTML----EKAALR------------ATDVVLEIG 57

  Fly    76 SGAGYFTRHLLDRESQFRRIILLESMDHFMPKIQELHTLYP--ERVKVRQGDFVNLWKLVYMDKM 138
            .|.|..|..:|:|.   :::|..|.......::|:.....|  .:::|..|||:.. :|.:.|. 
  Fly    58 PGTGNMTVRMLERA---KKVIACEIDTRLAAELQKRVQATPLQPKLQVLIGDFLKA-ELPFFDL- 117

  Fly   139 DGGSRVADLLSDVPQKAFTDDINMLVFGAVGSYPFFKHLINSLIFQTSLFNLGR--CEMILAMPP 201
                    .:::||.:             :.|...||.|::..:|:.::....|  .|.::|.| 
  Fly   118 --------CIANVPYQ-------------ISSPLIFKLLLHRPLFRCAVLMFQREFAERLVAKP- 160

  Fly   202 PIYIHLTCNNEIGYLIYRSTSVLFQILFEHKFIAKVPREDFLPQQMAYSPTKSSKLGKVQSINP- 265
                        |..:|...|:..|:|.....:.||.:.:|.|     .|...|.:.:::..|| 
  Fly   161 ------------GDKLYCRLSINTQLLARVDMLMKVGKNNFRP-----PPKVESSVVRLEPKNPP 208

  Fly   266 ------EYLYLVKFTPRRNLHELCQSQDLPALWFFIKQNYV---SRRNRII 307
                  |:..|.:....|....|..:..:.::...:::||.   |.||..|
  Fly   209 PPVNFTEWDGLTRIAFLRKNKTLAATFKVTSVLEMLEKNYKLYRSLRNEPI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtTFB2NP_649971.1 AdoMet_MTases 69..309 CDD:302624 52/253 (21%)
CG11837NP_651660.1 PTZ00338 16..305 CDD:240367 60/305 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11727
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.