DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtTFB2 and Isg15

DIOPT Version :9

Sequence 1:NP_649971.1 Gene:mtTFB2 / 41228 FlyBaseID:FBgn0037778 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_056598.2 Gene:Isg15 / 100038882 MGIID:1855694 Length:161 Species:Mus musculus


Alignment Length:146 Identity:29/146 - (19%)
Similarity:54/146 - (36%) Gaps:31/146 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 WKLVYMDKMDGGSRVADLLSDVPQKAFTDDINMLVFGAVGSYPFFKHLINSLIFQTSLFNLGRCE 194
            |.|..  ||.||:   |.|..|.......::...:...:| .|.|:   ..|..||::...|...
Mouse     3 WDLKV--KMLGGN---DFLVSVTNSMTVSELKKQIAQKIG-VPAFQ---QRLAHQTAVLQDGLTL 58

  Fly   195 MILAMPPPIYIHL---TCNNEIGYLI--YRSTSVLFQILFEHKFIAKVPREDFLPQQMAYSPTKS 254
            ..|.:.|...:.|   .|:..:..|:  .|..|.::::              ||.|.:   .|..
Mouse    59 SSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEV--------------FLTQTV---DTLK 106

  Fly   255 SKLGKVQSINPEYLYL 270
            .|:.:.:.::.:..:|
Mouse   107 KKVSQREQVHEDQFWL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtTFB2NP_649971.1 AdoMet_MTases 69..309 CDD:302624 29/146 (20%)
Isg15NP_056598.2 Ubl1_ISG15 3..75 CDD:340490 19/80 (24%)
Ubl2_ISG15 80..153 CDD:340508 9/60 (15%)
LRLRGG. /evidence=ECO:0000250 150..155
Involved in the ligation of specific target proteins. /evidence=ECO:0000250 151..155
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12633
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.