DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11722 and Ndufaf4

DIOPT Version :9

Sequence 1:NP_649970.1 Gene:CG11722 / 41227 FlyBaseID:FBgn0037777 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_081018.1 Gene:Ndufaf4 / 68493 MGIID:1915743 Length:173 Species:Mus musculus


Alignment Length:176 Identity:60/176 - (34%)
Similarity:89/176 - (50%) Gaps:17/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VARRANRFNVENRAHRVLEREKPTPAPKFDSNLRDMERTLELDPKFVDKLNMKDSSLDGRLKDVY 72
            |.|....||||.||.|.:.:.||:.|||..|....::......|:..:.::.||:.|...|:|||
Mouse     5 VTRALRNFNVEKRAEREISKRKPSMAPKHPSTRDLLQEHRSQYPEIEEVVSKKDNKLLSLLRDVY 69

  Fly    73 VTSQDRFIKRVQERQAAEAAADNVEQRPLPLERKTP--DDFEYGYLEPNRISPGHCTLRQALKFI 135
            |.|:|          ...|....||.|..|.|.:.|  :.|:....:   |..|..|:.:||..:
Mouse    70 VDSKD----------PVPALPVKVEPRQEPKEFRLPIGNHFDKNITD---IPKGKITVVEALTLL 121

  Fly   136 NDHQLDPESWPAKKIANEYKLKEPLVENILHYFKTFNMYI--PDQK 179
            |:|:|.||:|.|:|||.||.|:...|.::|.||.||.:.|  |:.:
Mouse   122 NNHKLSPETWTAEKIAQEYYLELKDVNSLLKYFVTFEVKILPPEDR 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11722NP_649970.1 UPF0240 1..178 CDD:284252 60/173 (35%)
Ndufaf4NP_081018.1 UPF0240 1..165 CDD:284252 59/172 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..40 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845798
Domainoid 1 1.000 88 1.000 Domainoid score I7945
eggNOG 1 0.900 - - E1_KOG4481
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40928
Inparanoid 1 1.050 88 1.000 Inparanoid score I5123
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45530
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007490
OrthoInspector 1 1.000 - - oto94922
orthoMCL 1 0.900 - - OOG6_109656
Panther 1 1.100 - - LDO PTHR13338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4682
SonicParanoid 1 1.000 - - X5615
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.