DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11722 and NDUFAF4

DIOPT Version :9

Sequence 1:NP_649970.1 Gene:CG11722 / 41227 FlyBaseID:FBgn0037777 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_054884.1 Gene:NDUFAF4 / 29078 HGNCID:21034 Length:175 Species:Homo sapiens


Alignment Length:176 Identity:60/176 - (34%)
Similarity:95/176 - (53%) Gaps:11/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SMVARRANRFNVENRAHRVLEREKPTPAPKFDSNLRDMERTLELDPKFVDKLNMKDSSLDGRLKD 70
            ::|.|....||:||||.|.:.:.||:.||:..|....:...:.|.|:...::..||..|...|||
Human     3 ALVIRGIRNFNLENRAEREISKMKPSVAPRHPSTNSLLREQISLYPEVKGEIARKDEKLLSFLKD 67

  Fly    71 VYVTSQDRFIKRVQERQAAEAAADNVEQRPLPLERKTPDDFEYGYLEPNRISPGHCTLRQALKFI 135
            |||.|:|. :..:|.: |||...:       |.|.:.|.|..:..:....|..|..::.:||..:
Human    68 VYVDSKDP-VSSLQVK-AAETCQE-------PKEFRLPKDHHFDMINIKSIPKGKISIVEALTLL 123

  Fly   136 NDHQLDPESWPAKKIANEYKLKEPLVENILHYFKTFNMYI--PDQK 179
            |:|:|.||:|.|:||..||:|::..|.::|.||.||.:.|  |:.|
Human   124 NNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11722NP_649970.1 UPF0240 1..178 CDD:284252 59/173 (34%)
NDUFAF4NP_054884.1 UPF0240 2..167 CDD:369079 58/172 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155334
Domainoid 1 1.000 96 1.000 Domainoid score I7371
eggNOG 1 0.900 - - E1_KOG4481
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40928
Inparanoid 1 1.050 96 1.000 Inparanoid score I5051
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45530
OrthoDB 1 1.010 - - D1395543at2759
OrthoFinder 1 1.000 - - FOG0007490
OrthoInspector 1 1.000 - - oto91342
orthoMCL 1 0.900 - - OOG6_109656
Panther 1 1.100 - - LDO PTHR13338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4682
SonicParanoid 1 1.000 - - X5615
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.