DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11722 and B0035.15

DIOPT Version :9

Sequence 1:NP_649970.1 Gene:CG11722 / 41227 FlyBaseID:FBgn0037777 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_502121.1 Gene:B0035.15 / 178039 WormBaseID:WBGene00007113 Length:283 Species:Caenorhabditis elegans


Alignment Length:214 Identity:52/214 - (24%)
Similarity:93/214 - (43%) Gaps:48/214 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RRAN--RFNVENRAHRVLEREKPTPAPKFDSNLRDMERTLELDPKFVDKLNMKDSSLDGRLKDVY 72
            :.||  :.:||..| ::.:.|.....||:.:     |::.|:..:...:|.||:.||...:..:|
 Worm    13 KNANYLKKSVEEVA-KIEKGETKVVPPKYPT-----EKSREVSEEIKKELAMKNESLVENMNKMY 71

  Fly    73 VTSQDRFIKRVQERQAAEAAADNVEQRPLP------LERKTPDDFEYGYLEP--NRISPGHCTLR 129
            :.|.|..     ||..:        .:.||      |.|..| .:|||:.||  .||.......:
 Worm    72 IKSTDPV-----ERWTS--------TKDLPTRESEFLHRNDP-IWEYGFYEPPVERIPKDKLMFK 122

  Fly   130 QALKFINDHQ--LDPESWPA-KKIANEY--------KLKEPLVENILHYFKTFNMYIPDQKYKDT 183
            :||:::...|  |...|.|| ||.|.|:        ::....:::|..||:.|     ::|.|..
 Worm   123 EALEYLRFRQELLSDSSSPAQKKQAAEFVADHVVTSRVNAETLDDIYEYFRPF-----ERKDKQK 182

  Fly   184 MLTQATQPLLRVKSSSEGN 202
            ::.:  ..|..::...:||
 Worm   183 VVNR--HALAALQDHVQGN 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11722NP_649970.1 UPF0240 1..178 CDD:284252 47/188 (25%)
B0035.15NP_502121.1 UPF0240 36..176 CDD:284252 41/163 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164009
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4481
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13338
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.