DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11722 and ndufaf4

DIOPT Version :9

Sequence 1:NP_649970.1 Gene:CG11722 / 41227 FlyBaseID:FBgn0037777 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001135673.1 Gene:ndufaf4 / 100216234 XenbaseID:XB-GENE-5852768 Length:177 Species:Xenopus tropicalis


Alignment Length:177 Identity:58/177 - (32%)
Similarity:91/177 - (51%) Gaps:13/177 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VARRANRFNVENRAHRVLEREKPTPAPKFDSNLRDMERTLELDPKFVDKLNMKDSSLDGRLKDVY 72
            :.|....||:||||||::.:|||.|||........:..|....|...||:..||:.|..|||:||
 Frog     5 LTRAMRNFNLENRAHRLIGKEKPRPAPTHPKTEDAVRATKTHHPDIEDKIRNKDNLLLTRLKEVY 69

  Fly    73 VTSQDRFIKRVQERQAAEAAADNVEQRPLP---LERKTPDDFEYGYLEPNRISPGHCTLRQALKF 134
            |.|.|. ...||.:.:..|.    ::..||   :.|::     ...::...|..|:.::.:||..
 Frog    70 VDSYDP-SSGVQTKVSRSAQ----KEHRLPKFAMNRES-----LMGVDVESIPKGNISVLEALTL 124

  Fly   135 INDHQLDPESWPAKKIANEYKLKEPLVENILHYFKTFNMYIPDQKYK 181
            :|:|:..||:|.|:||:.:|.|.....:::|.||..||:.|...|.|
 Frog   125 LNNHKNSPETWTAEKISEDYHLDLKNTQSLLEYFIPFNVKIIPPKDK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11722NP_649970.1 UPF0240 1..178 CDD:284252 56/172 (33%)
ndufaf4NP_001135673.1 UPF0240 2..169 CDD:369079 56/173 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I7930
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H40928
Inparanoid 1 1.050 87 1.000 Inparanoid score I4993
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395543at2759
OrthoFinder 1 1.000 - - FOG0007490
OrthoInspector 1 1.000 - - oto105120
Panther 1 1.100 - - LDO PTHR13338
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5615
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.