DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3909 and CAF4

DIOPT Version :9

Sequence 1:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_012962.3 Gene:CAF4 / 853908 SGDID:S000001744 Length:643 Species:Saccharomyces cerevisiae


Alignment Length:375 Identity:88/375 - (23%)
Similarity:154/375 - (41%) Gaps:81/375 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ENAHDS--QLWACTWGRDTAA-------SDPDDAVVEPEENPFDFDKKEARPKDFLVTGGLDD-L 63
            |.:||.  |:.:.|:.|:|.|       .:..:::     ...|||    .|...|.:....| :
Yeast   288 EKSHDKNRQIISETYSRNTTAFRMTIPHGEHGNSI-----TALDFD----TPWGTLCSSSYQDRI 343

  Fly    64 VKVWDLQEDNTLKLRHKLKGHALGVVSVAVSSDG-QTIASSSLDSTMCLWDARSGDKKHLLSFGP 127
            ||||||.....:   .:|.||...|..:.:.... ..:.:.|.|:|:.|||... .::..|...|
Yeast   344 VKVWDLNHGIQV---GELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNL-SREIYLDHSP 404

  Fly   128 VDLWTVQF-SPC-----------------NKYVISGLNDGKISMYSVETGKAEQTLD-------- 166
            :...|.:. :||                 ::.::||..|.||..:.:.|||..|.||        
Yeast   405 LKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHS 469

  Fly   167 --------AQNGKYTLSI------AYSPDGKYIASGAIDGIITIFDVAAGKVVQTLEGHAMPVRS 217
                    ..||...|..      |.......:|:|..|||:.::|:..||.|:.||||...:.|
Yeast   470 DIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITS 534

  Fly   218 LCFSPNSQLLLTASDDGHMKLYDVTHSDVVGTLSGHASWVLCVAFSE-DGKHFASSSSDNSVKI- 280
            |.|  :|:.|:|.|.|..::::|:..|.::..:    ::.|.|:..: |||.....:::..|.: 
Yeast   535 LKF--DSEKLVTGSMDNSVRIWDLRTSSILDVI----AYDLPVSSLDFDGKLITVGANEGGVNVF 593

  Fly   281 -------WDTSERKCLHTFAEHTDQVWGVRYSPGNDKVASASEDKSLNIY 323
                   |.|.|........|.:.::..|:|..|  .:.:...|..:|::
Yeast   594 NMERDEHWMTPEPPHSLDGDELSRRIAIVKYKDG--FLINGHNDGDINVW 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3909NP_649969.1 WD40 52..323 CDD:238121 76/321 (24%)
WD40 <54..326 CDD:225201 76/321 (24%)
WD40 repeat 89..127 CDD:293791 7/38 (18%)
WD40 repeat 130..166 CDD:293791 12/53 (23%)
WD40 repeat 174..209 CDD:293791 11/40 (28%)
WD40 repeat 215..251 CDD:293791 10/35 (29%)
WD40 repeat 257..293 CDD:293791 9/44 (20%)
WD40 repeat 299..323 CDD:293791 5/23 (22%)
CAF4NP_012962.3 Caf4 65..124 CDD:402971
WD40 318..641 CDD:238121 80/343 (23%)
WD40 repeat 322..360 CDD:293791 13/49 (27%)
WD40 repeat 366..422 CDD:293791 11/56 (20%)
WD40 repeat 427..461 CDD:293791 9/33 (27%)
WD40 repeat 472..526 CDD:293791 13/53 (25%)
WD40 repeat 532..563 CDD:293791 10/32 (31%)
WD40 repeat 571..611 CDD:293791 8/39 (21%)
WD40 repeat 617..641 CDD:293791 5/25 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.