DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3909 and SIF2

DIOPT Version :9

Sequence 1:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_009661.1 Gene:SIF2 / 852399 SGDID:S000000307 Length:535 Species:Saccharomyces cerevisiae


Alignment Length:319 Identity:72/319 - (22%)
Similarity:139/319 - (43%) Gaps:34/319 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DAVVEPEENPFD-----FDKKEARPKDFLVTGGLDDLVKVWDLQEDNTL--KLRHKLKGHALG-- 87
            |.:|....||.|     :.:|.:..:...:.....:..|.|.|    |:  :|||.....|..  
Yeast   158 DNIVSSTWNPLDESILAYGEKNSVARLARIVETDQEGKKYWKL----TIIAELRHPFALSASSGK 218

  Fly    88 ----VVSVAVSSDGQTIASSSLDSTMCLWDARSGDKKHLLSFGPVDLWTVQFSPCNKYVISGLND 148
                |..:|.|.||.:|.:...:..:.||: ::|...::|:|....:.:|:::....::||...:
Yeast   219 TTNQVTCLAWSHDGNSIVTGVENGELRLWN-KTGALLNVLNFHRAPIVSVKWNKDGTHIISMDVE 282

  Fly   149 GKISMYSVETGKAEQ----------TLDAQN----GKYTLSIAYSPDGKYIASGAIDGIITIFDV 199
            ....:::|.:|...|          :::|:|    |...:.:.:..|.|::..|. .|.|.::.:
Yeast   283 NVTILWNVISGTVMQHFELKETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGP-KGAIFVYQI 346

  Fly   200 AAGKVVQTLEGHAMPVRSLCFSPNSQLLLTASDDGHMKLYDVTHSDVVGTLSGHASWVLCVAFSE 264
            ........|.||..|:..|.|:..::|||:|||||.::::...:.:......||:..::..::..
Yeast   347 TEKTPTGKLIGHHGPISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVG 411

  Fly   265 DGKHFASSSSDNSVKIWDTSERKCLHTFAEHTDQVWGVRYSPGNDKVASASEDKSLNIY 323
            |.| ..|.|.|.||::|...:...|.........::..|.|....|.|.|..|..:|:|
Yeast   412 DDK-VISCSMDGSVRLWSLKQNTLLALSIVDGVPIFAGRISQDGQKYAVAFMDGQVNVY 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3909NP_649969.1 WD40 52..323 CDD:238121 65/292 (22%)
WD40 <54..326 CDD:225201 66/292 (23%)
WD40 repeat 89..127 CDD:293791 10/37 (27%)
WD40 repeat 130..166 CDD:293791 6/45 (13%)
WD40 repeat 174..209 CDD:293791 5/34 (15%)
WD40 repeat 215..251 CDD:293791 10/35 (29%)
WD40 repeat 257..293 CDD:293791 9/35 (26%)
WD40 repeat 299..323 CDD:293791 7/23 (30%)
SIF2NP_009661.1 LisH 7..31 CDD:369916
WD40 220..516 CDD:421866 58/253 (23%)
WD40 repeat 224..259 CDD:293791 9/35 (26%)
WD40 repeat 264..300 CDD:293791 6/35 (17%)
WD40 repeat 322..356 CDD:293791 5/34 (15%)
WD40 repeat 362..398 CDD:293791 10/35 (29%)
WD40 repeat 445..482 CDD:293791 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.970

Return to query results.
Submit another query.