| Sequence 1: | NP_649969.1 | Gene: | CG3909 / 41226 | FlyBaseID: | FBgn0027524 | Length: | 331 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_076469.1 | Gene: | Apaf1 / 78963 | RGDID: | 620575 | Length: | 1249 | Species: | Rattus norvegicus |
| Alignment Length: | 375 | Identity: | 78/375 - (20%) |
|---|---|---|---|
| Similarity: | 151/375 - (40%) | Gaps: | 89/375 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 11 AHDSQLWACTWGRDTAASDPDDAVVEPEENPFDFDKKEARPKDFLVTGGLDDLVKVWDLQEDNTL 75
Fly 76 KLRHKLKGHA--LGVVSVAVSSDGQTIASSSLDSTMCLWDARSGDKKHLLSFGPVDLWT-VQFSP 137
Fly 138 CNKYVISGLNDGKISMYSVETGKAEQTLDAQNGKYTLS--------------IAYSPDGKYIASG 188
Fly 189 AIDGIITIFDVAAGKVVQTLEGHAMPVRSLCFSPNSQLLLTASDDGHMKLYDVTHSDVVGTLSGH 253
Fly 254 ASWVLCVAFSEDGKHFASSSSDNSVKIWDTSERKCLHT-----------FAEH------TDQVWG 301
Fly 302 VR---------------------YSPGNDKVASASEDKSLNIYYCPPNAI 330 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3909 | NP_649969.1 | WD40 | 52..323 | CDD:238121 | 71/325 (22%) |
| WD40 | <54..326 | CDD:225201 | 72/326 (22%) | ||
| WD40 repeat | 89..127 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 130..166 | CDD:293791 | 8/36 (22%) | ||
| WD40 repeat | 174..209 | CDD:293791 | 8/48 (17%) | ||
| WD40 repeat | 215..251 | CDD:293791 | 7/35 (20%) | ||
| WD40 repeat | 257..293 | CDD:293791 | 12/46 (26%) | ||
| WD40 repeat | 299..323 | CDD:293791 | 6/44 (14%) | ||
| Apaf1 | NP_076469.1 | CARD_APAF1 | 7..92 | CDD:260034 | |
| AAA_16 | 126..245 | CDD:289934 | |||
| NB-ARC | 129..414 | CDD:279299 | |||
| WD40 | <598..685 | CDD:225201 | 8/56 (14%) | ||
| WD40 | 607..910 | CDD:238121 | 63/287 (22%) | ||
| WD 1-1 | 613..652 | ||||
| WD40 repeat | 623..655 | CDD:293791 | 78/375 (21%) | ||
| WD40 | 653..1038 | CDD:225201 | 78/375 (21%) | ||
| WD 1-2 | 655..694 | 13/68 (19%) | |||
| WD40 repeat | 661..697 | CDD:293791 | 12/65 (18%) | ||
| WD 1-3 | 697..738 | 9/40 (23%) | |||
| WD40 repeat | 702..740 | CDD:293791 | 8/38 (21%) | ||
| WD 1-4 | 741..780 | 9/38 (24%) | |||
| WD40 repeat | 747..789 | CDD:293791 | 8/43 (19%) | ||
| WD 1-5 | 796..837 | 6/40 (15%) | |||
| WD40 repeat | 801..837 | CDD:293791 | 6/35 (17%) | ||
| WD 1-6 | 838..877 | 9/38 (24%) | |||
| WD40 repeat | 843..882 | CDD:293791 | 8/38 (21%) | ||
| WD 1-7 | 880..910 | 13/29 (45%) | |||
| WD40 repeat | 885..909 | CDD:293791 | 9/23 (39%) | ||
| Interpropeller linker. /evidence=ECO:0000250 | 910..921 | 2/11 (18%) | |||
| WD 2-1 | 922..958 | 4/35 (11%) | |||
| WD 2-2 | 959..998 | 8/37 (22%) | |||
| WD40 | 961..1235 | CDD:238121 | 8/35 (23%) | ||
| WD40 | 961..>1235 | CDD:225201 | 8/35 (23%) | ||
| WD40 repeat | 964..1001 | CDD:293791 | 8/32 (25%) | ||
| WD 2-3 | 1001..1040 | ||||
| WD40 repeat | 1006..1030 | CDD:293791 | |||
| WD 2-4 | 1042..1080 | ||||
| WD40 repeat | 1048..1082 | CDD:293791 | |||
| WD 2-5 | 1083..1122 | ||||
| WD40 repeat | 1089..1124 | CDD:293791 | |||
| WD 2-6 | 1125..1164 | ||||
| WD40 repeat | 1130..1174 | CDD:293791 | |||
| WD 2-7 | 1176..1213 | ||||
| WD40 repeat | 1181..1203 | CDD:293791 | |||
| WD 2-8 | 1214..1249 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4155 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||