Sequence 1: | NP_649969.1 | Gene: | CG3909 / 41226 | FlyBaseID: | FBgn0027524 | Length: | 331 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_009041.2 | Gene: | TEP1 / 7011 | HGNCID: | 11726 | Length: | 2627 | Species: | Homo sapiens |
Alignment Length: | 411 | Identity: | 91/411 - (22%) |
---|---|---|---|
Similarity: | 143/411 - (34%) | Gaps: | 147/411 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 DFLVTGGLDDLVKVWDLQEDNTLKLRHKLKGHALGVVSVAVSSDGQTIASSSLDSTMCLWDARSG 117
Fly 118 D---------KKHLLSFGP---------------------------------------------- 127
Fly 128 ---------VDLWT-------VQFSPCNKYVISGL------------NDGKISMYSVETGKAEQT 164
Fly 165 LDAQNGKYTLSIAYSPDGKYIASG-AIDGIITIFDVAAG---------------------KVV-- 205
Fly 206 ----QTLEGHAM----------------PVRSLCFSPNSQLLLTASDDGHMKLYD---VTHSDVV 247
Fly 248 -----GT-LSGHASWVLCVAFSEDGKHFASSSSDNSVKIWDTSERK---CLHTF-AEHTDQVWGV 302
Fly 303 RYSPGNDKVASASEDKSLNIY 323 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3909 | NP_649969.1 | WD40 | 52..323 | CDD:238121 | 91/409 (22%) |
WD40 | <54..326 | CDD:225201 | 90/410 (22%) | ||
WD40 repeat | 89..127 | CDD:293791 | 9/46 (20%) | ||
WD40 repeat | 130..166 | CDD:293791 | 10/54 (19%) | ||
WD40 repeat | 174..209 | CDD:293791 | 16/62 (26%) | ||
WD40 repeat | 215..251 | CDD:293791 | 12/44 (27%) | ||
WD40 repeat | 257..293 | CDD:293791 | 14/39 (36%) | ||
WD40 repeat | 299..323 | CDD:293791 | 7/23 (30%) | ||
TEP1 | NP_009041.2 | TEP1 N-terminal 1 | 1..30 | ||
TEP1_N | 1..29 | CDD:283129 | |||
TEP1 N-terminal 2 | 31..60 | ||||
TEP1_N | 31..59 | CDD:283129 | |||
TEP1 N-terminal 3 | 61..90 | ||||
TEP1_N | 61..89 | CDD:283129 | |||
TEP1 N-terminal 4 | 91..120 | ||||
TEP1_N | 91..119 | CDD:283129 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 193..214 | ||||
TROVE | 226..676 | CDD:283406 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 383..402 | ||||
DUF4062 | 908..1008 | CDD:290011 | |||
NACHT | 1162..1337 | CDD:283404 | |||
WD 1 | 1411..1448 | ||||
WD 2 | 1674..1713 | ||||
WD40 | 1680..1955 | CDD:295369 | 45/228 (20%) | ||
WD40 | <1680..1824 | CDD:225201 | 20/96 (21%) | ||
WD40 repeat | 1680..1716 | CDD:293791 | |||
WD 3 | 1716..1754 | 8/26 (31%) | |||
WD40 repeat | 1722..1757 | CDD:293791 | 8/29 (28%) | ||
WD 4 | 1757..1796 | 9/38 (24%) | |||
WD40 repeat | 1762..1801 | CDD:293791 | 8/38 (21%) | ||
WD 5 | 1798..1837 | 2/38 (5%) | |||
WD40 | 1799..2190 | CDD:225201 | 73/339 (22%) | ||
WD40 repeat | 1804..1840 | CDD:293791 | 2/35 (6%) | ||
WD 6 | 1840..1879 | 3/38 (8%) | |||
WD40 repeat | 1845..1881 | CDD:293791 | 3/35 (9%) | ||
WD 7 | 1882..1921 | 7/38 (18%) | |||
WD40 repeat | 1888..1923 | CDD:293791 | 6/34 (18%) | ||
WD 8 | 1925..1964 | 14/39 (36%) | |||
WD 9 | 1967..2005 | 5/37 (14%) | |||
WD40 | 1972..2308 | CDD:238121 | 45/165 (27%) | ||
WD40 repeat | 1972..2013 | CDD:293791 | 5/40 (13%) | ||
WD 10 | 2008..2047 | 11/40 (28%) | |||
WD40 repeat | 2016..2059 | CDD:293791 | 12/44 (27%) | ||
WD40 | 2022..2391 | CDD:225201 | 36/113 (32%) | ||
WD 11 | 2059..2098 | 14/38 (37%) | |||
WD40 repeat | 2064..2103 | CDD:293791 | 13/38 (34%) | ||
WD 12 | 2105..2143 | 9/30 (30%) | |||
WD40 repeat | 2111..2145 | CDD:293791 | 6/24 (25%) | ||
WD 13 | 2146..2183 | ||||
WD40 repeat | 2151..2235 | CDD:293791 | |||
WD 14 | 2185..2233 | ||||
WD40 | 2231..>2391 | CDD:295369 | |||
WD 15 | 2236..2275 | ||||
WD40 repeat | 2241..2280 | CDD:293791 | |||
WD 16 | 2278..2317 | ||||
WD40 repeat | 2283..2307 | CDD:293791 | |||
WD 17 | 2319..2355 | ||||
WD40 repeat | 2326..2359 | CDD:293791 | |||
WD 18 | 2368..2417 | ||||
WD40 repeat | 2372..2418 | CDD:293791 | |||
WD 19 | 2459..2500 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2506..2551 | ||||
WD 20 | 2553..2590 | ||||
WD 21 | 2592..2626 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4155 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |