DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3909 and Wdr7

DIOPT Version :9

Sequence 1:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_076465.1 Gene:Wdr7 / 66031 RGDID:619836 Length:1488 Species:Rattus norvegicus


Alignment Length:343 Identity:71/343 - (20%)
Similarity:112/343 - (32%) Gaps:118/343 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LVTGGLDDLVKVWDLQEDNTLKLRHKLKGHALGVVSVA---VSSDGQTIASSSLDSTMCLWDARS 116
            :|||..|..:.:|||.|:..:..|..|.||...:..::   .|.|.|...|:|.:..|||||...
  Rat    34 IVTGCHDGQICLWDLSEELEVNPRALLFGHTAAITCLSKACASGDKQYTVSASANGEMCLWDVND 98

  Fly   117 GDKKHLLSFGPVDLWTVQFSPCNKYVISGLNDGKISMYSVETGKAEQTLDAQNGKY--------- 172
            |                   .|.::.........|..|....|...:.....:|.|         
  Rat    99 G-------------------RCIEFTKLACTHTGIQFYQFSVGNQREGRLLCHGHYPEILVVDAT 144

  Fly   173 TLSIAY------SPDGKYIASGAI----------------DGIITIFDVAA-----GKVVQTLEG 210
            :|.:.|      |||  :|:|.:|                .||:.::.|.:     .......|.
  Rat   145 SLEVLYSLVSKISPD--WISSMSIIRSHRTQEDTVVALSVTGILKVWIVTSEISGLQDTEPIFEE 207

  Fly   211 HAMPV-----RSLCFSPNSQLLLTASDDGHMKLYDVTHSDVVGTLSGHASWVLCVAFSEDGKHFA 270
            .:.|:     :||.|...:|..|......:.:::|          :|..| :||...||||:.:.
  Rat   208 ESKPIYCQNCQSLSFCAFTQRSLLVVCSKYWRVFD----------AGDYS-LLCSGPSEDGQTWT 261

  Fly   271 SSS--SDNSVKIWDTSER--------KCLHTFAEHTDQVWGVRYSPGNDK----VASASED---- 317
            ...  |.:.|.||..:.:        .||                |.:|.    |..|.|:    
  Rat   262 GGDFVSADKVIIWTENGQSYIYKLPASCL----------------PASDSFRSDVGKAVENLIPP 310

  Fly   318 --------KSLNIYYCPP 327
                    |...:..|||
  Rat   311 VQHSLLDQKDRELVICPP 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3909NP_649969.1 WD40 52..323 CDD:238121 68/337 (20%)
WD40 <54..326 CDD:225201 68/340 (20%)
WD40 repeat 89..127 CDD:293791 11/40 (28%)
WD40 repeat 130..166 CDD:293791 4/35 (11%)
WD40 repeat 174..209 CDD:293791 11/61 (18%)
WD40 repeat 215..251 CDD:293791 6/40 (15%)
WD40 repeat 257..293 CDD:293791 12/45 (27%)
WD40 repeat 299..323 CDD:293791 6/39 (15%)
Wdr7NP_076465.1 WD 1 17..56 8/21 (38%)
WD40 <19..199 CDD:225201 40/185 (22%)
WD40 <19..102 CDD:295369 23/86 (27%)
WD40 repeat 22..62 CDD:293791 10/27 (37%)
WD 2 62..104 14/60 (23%)
WD40 repeat 68..109 CDD:293791 12/59 (20%)
WD40 repeat 114..153 CDD:293791 7/38 (18%)
WD 3 156..199 9/44 (20%)
WD40 repeat 162..208 CDD:293791 6/45 (13%)
WD 4 324..366 3/5 (60%)
WD40 341..>592 CDD:225201
WD40 repeat 393..461 CDD:293791
WD 5 404..443
WD40 407..>594 CDD:295369
WD 6 462..507
WD40 repeat 468..522 CDD:293791
WD 7 558..597
WD40 repeat 563..589 CDD:293791
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 761..781
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..947
WD 8 1349..1388
WD40 repeat 1354..1390 CDD:293791
WD40 <1355..1424 CDD:295369
WD40 <1363..>1482 CDD:225201
WD 9 1390..1430
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.