DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3909 and Wdr53

DIOPT Version :9

Sequence 1:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_006248521.1 Gene:Wdr53 / 498097 RGDID:1559546 Length:380 Species:Rattus norvegicus


Alignment Length:298 Identity:72/298 - (24%)
Similarity:110/298 - (36%) Gaps:88/298 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VVEPEENPFDFDKKEARPKDFLVTGGLDD--LVKVWDLQEDNTLKLRHKLKGHALGVVSVAVSSD 96
            |.|.|.|....::.|:      :....||  .:|:.||::.   |:...||.|:....|||....
  Rat   114 VNEEEINCLSLNETES------LLASADDSGAIKILDLEKK---KVTRSLKRHSNICSSVAFRPQ 169

  Fly    97 -GQTIASSSLDSTMCLWDARSGDKKHLLSFGPVDLWTVQFSPCNKYVISGLNDGKISMYSVETGK 160
             .|::.|..||..:.||.        |....||  |                     :.:::..:
  Rat   170 RPQSLVSCGLDMQVMLWS--------LQKARPV--W---------------------ITNLQEDE 203

  Fly   161 AEQTLDAQ------NGKYTLSIAYSPDGKYIASGAIDGIITIFDVAAGKVVQTL--EGHAMPVRS 217
            .|:|...|      |.....||:.:..|...:.||.||.:.||.|...|..:.|  :||.:.|..
  Rat   204 TEETEGPQTPGRLLNPALAHSISVASCGNIFSCGAEDGKVRIFRVMGVKCERELGFKGHTLGVSQ 268

  Fly   218 LCFSPNSQLLLTASDDGHMKLYDVTHSDVVGTLSGHASWVLCVAFSEDGKHFASSSSDNSVKIWD 282
            :||.|.|.||||..:||.::|:||:                       ||  ......:.||   
  Rat   269 VCFLPESHLLLTGGNDGKIRLWDVS-----------------------GK--MEKQQKSPVK--- 305

  Fly   283 TSERKCLHTFAEHTDQVWGVRYSPGNDKVASASEDKSL 320
                   |...:.|.:  .||.:...|..|..:||:.|
  Rat   306 -------HIHRKKTKR--AVRPTQSGDSRAPGAEDEGL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3909NP_649969.1 WD40 52..323 CDD:238121 67/280 (24%)
WD40 <54..326 CDD:225201 67/278 (24%)
WD40 repeat 89..127 CDD:293791 10/38 (26%)
WD40 repeat 130..166 CDD:293791 3/35 (9%)
WD40 repeat 174..209 CDD:293791 12/36 (33%)
WD40 repeat 215..251 CDD:293791 14/35 (40%)
WD40 repeat 257..293 CDD:293791 5/35 (14%)
WD40 repeat 299..323 CDD:293791 7/22 (32%)
Wdr53XP_006248521.1 WD40 <30..303 CDD:225201 61/253 (24%)
WD40 30..291 CDD:295369 57/216 (26%)
WD40 repeat 35..71 CDD:293791
WD40 repeat 77..114 CDD:293791 72/298 (24%)
WD40 repeat 119..155 CDD:293791 8/44 (18%)
WD40 repeat 162..208 CDD:293791 14/76 (18%)
WD40 repeat 222..260 CDD:293791 12/37 (32%)
WD40 259..>380 CDD:225201 29/113 (26%)
WD40 repeat 266..292 CDD:293791 12/25 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.