DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3909 and wda

DIOPT Version :9

Sequence 1:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_651136.1 Gene:wda / 42750 FlyBaseID:FBgn0039067 Length:743 Species:Drosophila melanogaster


Alignment Length:324 Identity:69/324 - (21%)
Similarity:134/324 - (41%) Gaps:73/324 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CTWGRDTAASDPDDAVVEPEENPFDFDKK----EARPKDFLVTGGLDDLVKVWDLQEDNTLKLRH 79
            |.|..:..|:..:    |.:|:..|.|.|    |.|.::                      :.||
  Fly   439 CPWELNNCANQEE----ETDEDSSDEDVKCSEEERRERN----------------------RARH 477

  Fly    80 --------------KLKGHALGVVSVAVSSDGQTIASSSLDSTMCLWDARSGDKKHLLSFGPVDL 130
                          :|:||..||..|..|:....:.|.|.|:||..|.|.:.....:.......:
  Fly   478 CKYADNSYNEYGGFQLRGHTKGVTDVRFSAHYPLMYSVSKDATMRCWRAHNLHCAAIYRSHNYPI 542

  Fly   131 WTVQFSPCNKYVISGLNDGKISMYSVETGK-----AEQTLDAQNGKYTLSIAYSPDGKYIASGAI 190
            |.:..||..:||::|..|....::|:|...     |..|.|.:      .:|:.|:|.|||:|:.
  Fly   543 WCLDESPVGQYVVTGSKDLSARLWSLEKEHALIIYAGHTQDVE------CVAFHPNGNYIATGSA 601

  Fly   191 DGIITIFDVAAGKVVQTLEGHAMPVRSLCFSPNSQLLLTASDDGHMKLYDVTHSDVVGTLSGHAS 255
            |..:.::...:||:::........|..|.|||:.::|..|.::..::::|:.....:..|..|::
  Fly   602 DHSVRLWCATSGKLMRVFADCRQAVTQLAFSPDGKMLAAAGEETKVRIFDLAAGAQLAELKDHSA 666

  Fly   256 WVLCVAFSEDGKHFASSSSDNSVKIWDTSERKCLHTFAEHTDQVWGVRYSPGNDKVASASEDKS 319
            .:..:::|...:|.|::.||.::::||..                  :.||.:|..::.|...:
  Fly   667 SISSLSWSTHNRHLATACSDGTLRLWDIK------------------KLSPMSDNSSAGSSSSA 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3909NP_649969.1 WD40 52..323 CDD:238121 59/287 (21%)
WD40 <54..326 CDD:225201 59/285 (21%)
WD40 repeat 89..127 CDD:293791 9/37 (24%)
WD40 repeat 130..166 CDD:293791 11/40 (28%)
WD40 repeat 174..209 CDD:293791 10/34 (29%)
WD40 repeat 215..251 CDD:293791 8/35 (23%)
WD40 repeat 257..293 CDD:293791 7/35 (20%)
WD40 repeat 299..323 CDD:293791 4/21 (19%)
wdaNP_651136.1 TAF5_NTD2 104..273 CDD:298747
WD40 324..>700 CDD:225201 66/310 (21%)
WD40 491..700 CDD:238121 54/232 (23%)
WD40 repeat 501..537 CDD:293791 9/35 (26%)
WD40 repeat 542..578 CDD:293791 9/35 (26%)
WD40 repeat 585..619 CDD:293791 10/39 (26%)
WD40 repeat 626..662 CDD:293791 8/35 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.