| Sequence 1: | NP_649969.1 | Gene: | CG3909 / 41226 | FlyBaseID: | FBgn0027524 | Length: | 331 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_725799.1 | Gene: | CG30116 / 37126 | FlyBaseID: | FBgn0028496 | Length: | 1922 | Species: | Drosophila melanogaster |
| Alignment Length: | 451 | Identity: | 88/451 - (19%) |
|---|---|---|---|
| Similarity: | 153/451 - (33%) | Gaps: | 181/451 - (40%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 53 DFLVTGGLDDLVKVWDLQ------------------------------EDNTLKLR--------H 79
Fly 80 KLKGHALGVVSVAVSSDGQTIASSSLDSTMCLWDARSGDKKHLLSFGPVDLWTVQFSPCNKYVIS 144
Fly 145 GLNDGKISMYS----------------------------------------VETGKAEQTLDAQN 169
Fly 170 GKY-------------TLS--------IAYSPDGKYIASGAIDGIITIFDVAAGKVVQTLEGHAM 213
Fly 214 PV---------------------------------------RSLCFSPNSQLLLTASDDGHMKL- 238
Fly 239 --------YDVTHSDVV----------------------------GTLS----GHASWVLCVAFS 263
Fly 264 EDGK-HFASSSSDNSVKIWDTSERKCLHTFAEHTDQVWGVRYSPGNDKVASASEDKSLNIY 323 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3909 | NP_649969.1 | WD40 | 52..323 | CDD:238121 | 88/449 (20%) |
| WD40 | <54..326 | CDD:225201 | 87/450 (19%) | ||
| WD40 repeat | 89..127 | CDD:293791 | 7/37 (19%) | ||
| WD40 repeat | 130..166 | CDD:293791 | 6/75 (8%) | ||
| WD40 repeat | 174..209 | CDD:293791 | 9/42 (21%) | ||
| WD40 repeat | 215..251 | CDD:293791 | 12/111 (11%) | ||
| WD40 repeat | 257..293 | CDD:293791 | 13/36 (36%) | ||
| WD40 repeat | 299..323 | CDD:293791 | 9/23 (39%) | ||
| CG30116 | NP_725799.1 | AAA_16 | 359..505 | CDD:289934 | |
| WD40 repeat | 901..937 | CDD:293791 | |||
| WD40 | 933..1282 | CDD:238121 | 43/243 (18%) | ||
| WD40 repeat | 942..982 | CDD:293791 | |||
| WD40 repeat | 988..1024 | CDD:293791 | |||
| WD40 | 1022..1484 | CDD:225201 | 86/445 (19%) | ||
| WD40 repeat | 1029..1064 | CDD:293791 | 10/24 (42%) | ||
| WD40 repeat | 1071..1106 | CDD:293791 | 6/34 (18%) | ||
| WD40 repeat | 1112..1147 | CDD:293791 | 6/34 (18%) | ||
| WD40 repeat | 1216..1252 | CDD:293791 | 4/35 (11%) | ||
| WD40 | 1248..1502 | CDD:238121 | 53/241 (22%) | ||
| WD40 repeat | 1258..1294 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 1299..1335 | CDD:293791 | 1/35 (3%) | ||
| WD40 repeat | 1340..1374 | CDD:293791 | 6/33 (18%) | ||
| WD40 repeat | 1379..1415 | CDD:293791 | 3/35 (9%) | ||
| WD40 repeat | 1421..1458 | CDD:293791 | 13/36 (36%) | ||
| WD40 repeat | 1464..1488 | CDD:293791 | 9/23 (39%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4155 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||