DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3909 and caf4

DIOPT Version :9

Sequence 1:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001342939.1 Gene:caf4 / 3361526 PomBaseID:SPAC664.15 Length:651 Species:Schizosaccharomyces pombe


Alignment Length:331 Identity:78/331 - (23%)
Similarity:137/331 - (41%) Gaps:70/331 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DFDKKEARPKDFLVTGGLDDLVKVWDLQEDNTLKLRHKLKGHALGVVSVAVSSDGQTIASSSLDS 107
            ||    :.|...|.|...|..|||||:.   .:.....||||:..|..:|:..  ..||:.|:|:
pombe   339 DF----SHPFGTLATASTDKTVKVWDMA---GVVYLGSLKGHSDYVSCLAIQD--SFIATGSMDT 394

  Fly   108 TMCLWDARSGDKKHLLSFGPVD----------------LWTVQFSP-------CNKYVISGLNDG 149
            |:.||:.   |...|....||:                :.|...:|       .:..:|:|.:|.
pombe   395 TVRLWNL---DNDVLHKDNPVEESLNSPPDQPVDNATNVLTSHTAPVTALALSSDDVLITGADDK 456

  Fly   150 KISMYSVETGKAEQTL--------DAQNGKYTLSIAYSPD---------GKYIASGAIDGIITIF 197
            .:..:.:.||:..|||        |....:..:|..|..:         ...:|||.:||:|.|:
pombe   457 TVRQWDIVTGRCIQTLDFVWAETHDTSTSQILVSDTYKQEPFIRALDCLDAAVASGTVDGLIRIW 521

  Fly   198 DVAAGKVVQTLEGHAMPVRSLCFSPNSQLLLTASDDGHMKLYDVTHSDVVGTLSGHASWVLCVAF 262
            |:..|..|::..||..|:.||.|..|.  |.:.|.|..::::|:.....:..:..... |..:..
pombe   522 DLRIGLPVRSFIGHTAPISSLQFDSNH--LYSGSYDNSVRIWDLRSGSPINIIPMEKK-VNSLRL 583

  Fly   263 SEDGKHFASSSSDNSVKIWDT-SERKCLHTFAEHTDQV--------WGVRYSPGNDK-VASASED 317
            .:.  ..|.:|.:.:|:|:|| |.|..:.:...|:|.:        ..|:|   .|: :.....|
pombe   584 YQG--RLAVASDEPNVRIFDTVSNRNWICSIPSHSDSIAAEPNSVPTSVQY---KDRFLVDGKSD 643

  Fly   318 KSLNIY 323
            .|::::
pombe   644 GSVSVF 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3909NP_649969.1 WD40 52..323 CDD:238121 75/320 (23%)
WD40 <54..326 CDD:225201 75/320 (23%)
WD40 repeat 89..127 CDD:293791 10/37 (27%)
WD40 repeat 130..166 CDD:293791 10/50 (20%)
WD40 repeat 174..209 CDD:293791 12/43 (28%)
WD40 repeat 215..251 CDD:293791 8/35 (23%)
WD40 repeat 257..293 CDD:293791 9/36 (25%)
WD40 repeat 299..323 CDD:293791 5/32 (16%)
caf4NP_001342939.1 WD40 324..650 CDD:238121 78/331 (24%)
WD40 repeat 336..372 CDD:293791 12/39 (31%)
WD40 repeat 377..431 CDD:293791 13/58 (22%)
WD40 repeat 439..473 CDD:293791 7/33 (21%)
WD40 repeat 484..533 CDD:293791 12/48 (25%)
WD40 repeat 539..573 CDD:293791 8/35 (23%)
WD40 repeat 578..600 CDD:293791 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.