Sequence 1: | NP_649969.1 | Gene: | CG3909 / 41226 | FlyBaseID: | FBgn0027524 | Length: | 331 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_863651.1 | Gene: | APAF1 / 317 | HGNCID: | 576 | Length: | 1248 | Species: | Homo sapiens |
Alignment Length: | 296 | Identity: | 72/296 - (24%) |
---|---|---|---|
Similarity: | 122/296 - (41%) | Gaps: | 52/296 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 EENAHDSQLWACTWGRD-----TAASDPD----DAVVEPEENPFDFDKKEARPKDF--------L 55
Fly 56 VTGGLDDLVKVWDLQEDNTLKLRHKLKGHALGVVSVAVSSDGQTIASSSLDSTMCLWDARSGDKK 120
Fly 121 HLLSFGPVDLWTVQFSPCNKYVISGLNDGKISMYSVETGKAEQTLDAQNGKYTLSIAYSPDGKYI 185
Fly 186 ASGAIDGIITIFDV-AAGKVVQTLEGHAMPVRSLCFSPNSQLLLTASDDGHMKLYDVTHSDVVGT 249
Fly 250 LSGHASWVLCVAFSEDGKHFASSSSDNSVKIWDTSE 285 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3909 | NP_649969.1 | WD40 | 52..323 | CDD:238121 | 64/243 (26%) |
WD40 | <54..326 | CDD:225201 | 64/241 (27%) | ||
WD40 repeat | 89..127 | CDD:293791 | 12/37 (32%) | ||
WD40 repeat | 130..166 | CDD:293791 | 4/35 (11%) | ||
WD40 repeat | 174..209 | CDD:293791 | 9/35 (26%) | ||
WD40 repeat | 215..251 | CDD:293791 | 7/35 (20%) | ||
WD40 repeat | 257..293 | CDD:293791 | 12/29 (41%) | ||
WD40 repeat | 299..323 | CDD:293791 | |||
APAF1 | NP_863651.1 | CARD_APAF1 | 7..92 | CDD:260034 | |
NB-ARC | 129..374 | CDD:395745 | |||
APAF1_C | 453..587 | CDD:407760 | |||
WD40 | 607..910 | CDD:238121 | 70/291 (24%) | ||
WD 1-1 | 613..652 | 72/296 (24%) | |||
WD40 repeat | 623..655 | CDD:293791 | 1/2 (50%) | ||
WD 1-2 | 655..694 | 6/38 (16%) | |||
WD40 repeat | 660..697 | CDD:293791 | 4/36 (11%) | ||
WD 1-3 | 697..738 | 11/43 (26%) | |||
WD40 repeat | 703..741 | CDD:293791 | 11/40 (28%) | ||
WD 1-4 | 741..780 | 15/38 (39%) | |||
WD40 repeat | 746..791 | CDD:293791 | 14/58 (24%) | ||
WD 1-5 | 796..836 | 10/56 (18%) | |||
WD40 repeat | 802..870 | CDD:293791 | 17/68 (25%) | ||
WD 1-6 | 838..877 | 9/38 (24%) | |||
WD 1-7 | 880..910 | 14/29 (48%) | |||
WD40 repeat | 885..939 | CDD:293791 | 12/29 (41%) | ||
Interpropeller linker. /evidence=ECO:0000250 | 910..921 | 1/4 (25%) | |||
WD 2-1 | 922..958 | ||||
WD 2-2 | 959..998 | ||||
WD40 | 961..1234 | CDD:238121 | |||
WD40 repeat | 964..990 | CDD:293791 | |||
WD 2-3 | 1001..1040 | ||||
WD40 repeat | 1006..1030 | CDD:293791 | |||
WD 2-4 | 1042..1080 | ||||
WD40 repeat | 1047..1082 | CDD:293791 | |||
WD 2-5 | 1083..1122 | ||||
WD40 repeat | 1089..1124 | CDD:293791 | |||
WD 2-6 | 1125..1164 | ||||
WD40 repeat | 1130..1172 | CDD:293791 | |||
WD 2-7 | 1175..1212 | ||||
WD40 repeat | 1180..1213 | CDD:293791 | |||
WD 2-8 | 1213..1248 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4155 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |