DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3909 and cdt2

DIOPT Version :9

Sequence 1:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_593588.1 Gene:cdt2 / 2542374 PomBaseID:SPAC17H9.19c Length:490 Species:Schizosaccharomyces pombe


Alignment Length:380 Identity:81/380 - (21%)
Similarity:133/380 - (35%) Gaps:143/380 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EEN-----------AHDSQLWACTWGRD-----TAASDPDDAVVEPEENPFDFDKKE-------- 48
            |||           ||::.:::..:.:|     |::.|....|       ||...::        
pombe   164 EENQPSARRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKV-------FDLSTQQCITRLGRR 221

  Fly    49 ---------ARPKDF-------LVTGGLDDLVKVWDLQ-----------EDNTLKLR--HKLKGH 84
                     .:..:|       ||:...|..:..||::           :...|::|  |:..|.
pombe   222 GVDGYHSHSVKQVNFCNDSPYNLVSCSRDGSIIFWDMRTHGITIDGEHFQKPVLRIRKAHENSGR 286

  Fly    85 ALGVVSVA--VSSDGQTIASSSLDSTMCLWDARSGDKKHLL-------------SFGPVDLWTVQ 134
            ...:.|..  ..|..|.|:|.|.:|.:.|||.|:......|             .||..::.|  
pombe   287 DCSITSATWLPQSTSQVISSCSANSALKLWDLRTVHTVRPLPAATTPELTTSKRDFGVTNVCT-- 349

  Fly   135 FSPCNKYVISGLNDGKISMYS---VETGKAEQTLD--AQNGKYTLSIAYSPDGKYIASGAIDGI- 193
             ||..:.:.:...|..|..||   :.:|..:...|  .:...:.:.:|.||||..:|.|.  |: 
pombe   350 -SPDGERIYAASRDSIIYEYSSRHLNSGFCKTYKDPRLRISSFYVKLACSPDGATLACGG--GVQ 411

  Fly   194 -----ITIFDVAAGKVVQTLEGHAMPVRSLCFSPNSQLLLTASDDGHMKLYDVTHSDVVGTLSGH 253
                 :.:||....                |   :|..:||.   ||.|  |||..|        
pombe   412 DKTSGVVVFDTTRN----------------C---SSSAMLTG---GHTK--DVTAVD-------- 444

  Fly   254 ASWVLCVAFSEDGKHFASSSSDNSVKIWDTSERKCLHTFAEHTDQ-------VWG 301
              |      |.:|: .||.|.|.||::|::|    ||..|.:..:       .||
pombe   445 --W------SSEGQ-LASISDDGSVRVWNSS----LHGSAANLREKNFSEIFYWG 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3909NP_649969.1 WD40 52..323 CDD:238121 70/303 (23%)
WD40 <54..326 CDD:225201 70/301 (23%)
WD40 repeat 89..127 CDD:293791 13/52 (25%)
WD40 repeat 130..166 CDD:293791 8/38 (21%)
WD40 repeat 174..209 CDD:293791 10/40 (25%)
WD40 repeat 215..251 CDD:293791 11/35 (31%)
WD40 repeat 257..293 CDD:293791 12/35 (34%)
WD40 repeat 299..323 CDD:293791 2/3 (67%)
cdt2NP_593588.1 WD40 repeat 131..178 CDD:293791 3/13 (23%)
WD40 <132..208 CDD:295369 9/50 (18%)
WD40 <171..490 CDD:225201 78/373 (21%)
WD40 173..464 CDD:295369 71/343 (21%)
WD40 repeat 184..222 CDD:293791 6/44 (14%)
WD40 repeat 231..279 CDD:293791 7/47 (15%)
WD40 repeat 291..337 CDD:293791 12/45 (27%)
WD40 repeat 344..382 CDD:293791 8/40 (20%)
WD40 repeat 392..433 CDD:293791 12/61 (20%)
WD40 repeat 440..463 CDD:293791 12/39 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.