DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3909 and hif2

DIOPT Version :9

Sequence 1:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_587735.1 Gene:hif2 / 2538701 PomBaseID:SPCC1235.09 Length:564 Species:Schizosaccharomyces pombe


Alignment Length:374 Identity:86/374 - (22%)
Similarity:143/374 - (38%) Gaps:78/374 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KEENAHDSQLWACTWGRDTAASDPDDAVV----EPEENPFDF--------DKKEARP-------- 51
            :..|::|.||...   :|..:..|...|:    :.|:...|.        :|..|||        
pombe   118 EHNNSNDHQLKIL---QDKGSGSPSSPVMPFKDKIEKRDIDITMADESNVEKDPARPIAVYNSSP 179

  Fly    52 -------KDFLVTGGLD---DLVKVWDLQEDNTLKLRHKLKGHALGVVSVAVSSDGQTIASSSL- 105
                   |....|||.|   |..||...:...|......|......|...::.....|:||.|: 
pombe   180 VTEITEIKQVTFTGGEDIKSDFFKVIPTKHPVTCADWRPLLQENYHVYEFSIGMTNATLASVSIC 244

  Fly   106 --------DSTMCLWDARSGDKKHLLSFGPVDLWTVQFSPCNKYVISGLNDGKISMYSVETGKAE 162
                    .:..||..          ||...|:..|.::....::......|.|.:|.   ....
pombe   245 EEQNDFKAKTDYCLQS----------SFDNQDITGVAWNNSGSFLAYAFFSGVIEIYD---SHGS 296

  Fly   163 QTLDAQNGK-YTLSIAYSPDGKYIASGAIDGIITIFD--VAAGKVVQTLEGHAMPVRSLCFSPNS 224
            |.|...|.| ..||:.:|....|:|:|:.||.||:||  ......:.||....:.:..:.|..  
pombe   297 QILSFHNNKGPVLSLKWSGTDTYLAAGSADGTITLFDQLKQTQYSIDTLASSVLDIEWISFDE-- 359

  Fly   225 QLLLTASDDGHMKLYDVTHSDVVGTLS-GHASWVLCVAFSEDGKHFASSSSDNSVKIW---DTSE 285
              .:|:..:|.:::|.|.....|.|:| .|.:.::.:.::.......::|||.:||:|   |...
pombe   360 --FVTSDVEGSLRVYKVDGKAPVSTVSHAHDNSIVALRYNLRISLLLTASSDTTVKLWSRGDAGA 422

  Fly   286 RKCLHTFAEHTDQV----WGVRYSPGNDKVASASEDKSLNIYYCPPNAI 330
            .:|||.|: .:..|    |.:|  .|...:|.|| :..:::|    |||
pombe   423 FECLHVFS-FSSPVNCIDWNLR--EGTPILAVAS-NSIVSMY----NAI 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3909NP_649969.1 WD40 52..323 CDD:238121 69/293 (24%)
WD40 <54..326 CDD:225201 69/294 (23%)
WD40 repeat 89..127 CDD:293791 8/46 (17%)
WD40 repeat 130..166 CDD:293791 5/35 (14%)
WD40 repeat 174..209 CDD:293791 13/36 (36%)
WD40 repeat 215..251 CDD:293791 7/35 (20%)
WD40 repeat 257..293 CDD:293791 10/38 (26%)
WD40 repeat 299..323 CDD:293791 7/27 (26%)
hif2NP_587735.1 LisH 4..30 CDD:285685
WD40 <263..524 CDD:225201 54/216 (25%)
WD40 267..523 CDD:295369 53/212 (25%)
WD40 repeat 267..301 CDD:293791 6/36 (17%)
WD40 repeat 309..347 CDD:293791 14/37 (38%)
WD40 repeat 349..384 CDD:293791 7/38 (18%)
WD40 repeat 392..430 CDD:293791 10/37 (27%)
WD40 repeat 435..472 CDD:293791 11/36 (31%)
WD40 repeat 478..515 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.970

Return to query results.
Submit another query.