DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3909 and SPCC126.01c

DIOPT Version :9

Sequence 1:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_588444.2 Gene:SPCC126.01c / 2538691 PomBaseID:SPCC126.01c Length:369 Species:Schizosaccharomyces pombe


Alignment Length:341 Identity:67/341 - (19%)
Similarity:127/341 - (37%) Gaps:95/341 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KEENAHDSQLWACTWGRDTAASDPDDAVVEPEENP---------FDFDKKEARPKDF--LVTGGL 60
            |||.:|:                       |..||         .:.|:...:.|.|  |.....
pombe    22 KEEKSHN-----------------------PNGNPRNLKAKILNIELDRTTPKKKQFPRLFVCEA 63

  Fly    61 DDLVKVWDLQEDNTLKLRHKLKGHALGVVSVAVSS---DGQTIASSSLDSTMCLWDARSGDKKHL 122
            ..:.|::||:.:.|.|   ..|||:..|....:.|   ||:.                       
pombe    64 SHICKLYDLEINKTCK---TYKGHSGPVTCCQIESLRKDGKV----------------------- 102

  Fly   123 LSFGPVDLWTVQFSPCNKYVISGLNDGKISMYSVETGKAEQTLDAQNGKYTLSIAYSPDGKYIAS 187
                             :::.:|..|..|..::|.||:..:||..........:....:| .:.|
pombe   103 -----------------RHIYTGSWDHTIKKWNVSTGECVETLIGHTDYVKCLLLLEEEG-LLLS 149

  Fly   188 GAIDGIITIFDVAA--GKVVQTLEGHAMPVRSLCFSPNSQLLLTASDDGHMKLYDVTHSDVVGT- 249
            |:.|..:.::||::  .:::..|.||:..:..:...||:.:..|...:..::.:.:|  .|.|: 
pombe   150 GSTDASLIVWDVSSQPSRLLYKLTGHSRGIECITRQPNTDIFWTCGSESSIRCWHIT--KVGGSQ 212

  Fly   250 -----LSGHASWVLCVAFS-EDGKHFASSSSDNSVKIWDTSERKCLHTFAEHTDQVWGV-RYSPG 307
                 ..||.|.|.|:.|. :|.:...::|:|.:|:.|...:.....|..||.|....| ..:.|
pombe   213 LEEEGFWGHQSNVYCLLFDPQDSEALWTASADKTVREWSLYQGIHEETRMEHPDVCTDVLTLADG 277

  Fly   308 NDKVASASEDKSLNIY 323
            |  :|:|..|:.:.::
pombe   278 N--IATACRDEEIRVW 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3909NP_649969.1 WD40 52..323 CDD:238121 59/285 (21%)
WD40 <54..326 CDD:225201 58/285 (20%)
WD40 repeat 89..127 CDD:293791 3/40 (8%)
WD40 repeat 130..166 CDD:293791 7/35 (20%)
WD40 repeat 174..209 CDD:293791 6/36 (17%)
WD40 repeat 215..251 CDD:293791 6/41 (15%)
WD40 repeat 257..293 CDD:293791 9/36 (25%)
WD40 repeat 299..323 CDD:293791 6/24 (25%)
SPCC126.01cNP_588444.2 WD40 54..332 CDD:238121 58/286 (20%)
WD40 <58..334 CDD:225201 57/282 (20%)
WD40 repeat 89..130 CDD:293791 11/80 (14%)
WD40 repeat 135..173 CDD:293791 6/38 (16%)
WD40 repeat 180..217 CDD:293791 6/38 (16%)
WD40 repeat 225..263 CDD:293791 9/37 (24%)
WD40 repeat 271..307 CDD:293791 6/23 (26%)
WD40 repeat 309..331 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.