DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3909 and Dcaf10

DIOPT Version :9

Sequence 1:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_694807.2 Gene:Dcaf10 / 242418 MGIID:2140179 Length:566 Species:Mus musculus


Alignment Length:155 Identity:47/155 - (30%)
Similarity:76/155 - (49%) Gaps:6/155 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SIAYSPDGKYIASGAIDGIITIFDVAAGKVVQTL-EGHAMPVRSLCFSPNSQLLLTASDDGHMKL 238
            ::.|||||..:........:.:||..:.|.::|| |.|...|.::.|..| :|..|.|||..:.|
Mouse   180 NLEYSPDGSVLTVACEQTEVLLFDPISSKHIKTLSEAHEDCVNNIRFLDN-RLFATCSDDTTIAL 243

  Fly   239 YDVTHSDV-VGTLSGHASWVLCVAFSEDGKHFASSSSDNSVKIWDT---SERKCLHTFAEHTDQV 299
            :|:...:. |.||.||.|||..:.:..:.:...:|..|.:|.||||   :|..|.|....||..:
Mouse   244 WDLRKLNTKVCTLHGHTSWVKNIEYDTNTRLLVTSGFDGNVIIWDTNRCTEDGCPHKKFFHTRFL 308

  Fly   300 WGVRYSPGNDKVASASEDKSLNIYY 324
            ..:|.:|...|:..::....|.|.:
Mouse   309 MRMRLTPDCSKMLISTSSGYLLILH 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3909NP_649969.1 WD40 52..323 CDD:238121 46/152 (30%)
WD40 <54..326 CDD:225201 47/155 (30%)
WD40 repeat 89..127 CDD:293791
WD40 repeat 130..166 CDD:293791
WD40 repeat 174..209 CDD:293791 10/34 (29%)
WD40 repeat 215..251 CDD:293791 12/36 (33%)
WD40 repeat 257..293 CDD:293791 11/38 (29%)
WD40 repeat 299..323 CDD:293791 4/23 (17%)
Dcaf10NP_694807.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..123
WD40 <171..326 CDD:295369 45/146 (31%)
WD 1 173..212 8/31 (26%)
WD40 <178..>326 CDD:225201 45/146 (31%)
WD40 repeat 179..214 CDD:293791 9/33 (27%)
WD 2 216..254 11/38 (29%)
WD40 repeat 221..257 CDD:293791 12/36 (33%)
WD 3 258..297 13/38 (34%)
WD40 repeat 263..289 CDD:293791 6/25 (24%)
WD 4 303..342 7/31 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..413
WD 5 415..455
WD 6 477..515
WD40 524..562 CDD:197651
WD 7 533..566
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.