DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3909 and rbc-2

DIOPT Version :9

Sequence 1:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001368042.1 Gene:rbc-2 / 190267 WormBaseID:WBGene00004314 Length:1373 Species:Caenorhabditis elegans


Alignment Length:234 Identity:52/234 - (22%)
Similarity:92/234 - (39%) Gaps:50/234 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DAVVEPEENPFDFDKKEARPKDFLVTGGLDDLVKVWDLQEDNTLKLRHKLKGHALGVVSVAVSSD 96
            ||.|.....||:.|.:  ....:.|:|..|..|.||::.....:   |:...|...|.|..:...
 Worm   485 DAAVRSMFYPFEHDTR--YDPQYFVSGSDDFSVIVWNINSGTRI---HRFTVHGGPVKSFMLPPS 544

  Fly    97 G------QTIASSSLDSTMCLWDARSGDKKHLLSFGPVDLWTVQFSPCNKYVISGLNDGKISMYS 155
            .      :.|||.:.|:|:.|.:.|......|.|..|..:..|::.|.:.:::..|.||.:.::.
 Worm   545 NCSKQVTKCIASLAADNTIALLNIRDSKCMLLASRHPFPIIQVKWRPLDDFMLVKLADGSVYVWQ 609

  Fly   156 VETGKAEQTLDAQNGKYTLSIAYSPDGKYIASGAI-DGIITIFDVAAG---KVVQTLEGHAMPVR 216
            :||...::                     ||:|.: :.|:|..|...|   ...:|...||:.  
 Worm   610 METANLDR---------------------IATGLLAEDIMTACDEQIGVEEGTDETSAHHAVQ-- 651

  Fly   217 SLCFSPNSQLLLTASDDGHMKLYDVTHSDVVGTLSGHAS 255
                      |:.|..:.:|:.  |....|.|::||.|:
 Worm   652 ----------LIRALKNKNMEA--VKQKVVGGSVSGAAT 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3909NP_649969.1 WD40 52..323 CDD:238121 46/214 (21%)
WD40 <54..326 CDD:225201 46/212 (22%)
WD40 repeat 89..127 CDD:293791 10/43 (23%)
WD40 repeat 130..166 CDD:293791 7/35 (20%)
WD40 repeat 174..209 CDD:293791 8/38 (21%)
WD40 repeat 215..251 CDD:293791 6/35 (17%)
WD40 repeat 257..293 CDD:293791
WD40 repeat 299..323 CDD:293791
rbc-2NP_001368042.1 WD40 27..>118 CDD:421866
WD40 repeat 33..68 CDD:293791
WD40 repeat 73..108 CDD:293791
WD40 repeat 112..160 CDD:293791
WD40 repeat 168..211 CDD:293791
WD40 repeat 264..291 CDD:293791
WD40 373..621 CDD:421866 35/161 (22%)
WD40 repeat 488..530 CDD:293791 11/46 (24%)
WD40 repeat 584..610 CDD:293791 5/25 (20%)
WD40 <1246..1313 CDD:421866
WD40 repeat 1286..1337 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.