Sequence 1: | NP_649969.1 | Gene: | CG3909 / 41226 | FlyBaseID: | FBgn0027524 | Length: | 331 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498555.1 | Gene: | B0280.9 / 175994 | WormBaseID: | WBGene00015104 | Length: | 429 | Species: | Caenorhabditis elegans |
Alignment Length: | 262 | Identity: | 52/262 - (19%) |
---|---|---|---|
Similarity: | 115/262 - (43%) | Gaps: | 37/262 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 KDFLVTGGLDDLVKVWDLQEDNTLKLRHKLKGHALGVVSVAVSSDGQTIASSSLDSTMCLWDARS 116
Fly 117 GDKKHLLSFG-PVDLWTVQFSPCNK---YVISGLNDGKISMYSV---ETGKAEQTLDAQNGKYTL 174
Fly 175 SIAYSPDGKYIASGAIDGIITIF------DVAAGKVVQTLEGHAMPVRSLCFSPNSQLLLTASD- 232
Fly 233 -DGHMKLYDVTHSDVVGTL---SGHASWVLCVAFSEDGKHFASSSSDNSVKIWDTSERKCLHTFA 293
Fly 294 EH 295 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3909 | NP_649969.1 | WD40 | 52..323 | CDD:238121 | 52/262 (20%) |
WD40 | <54..326 | CDD:225201 | 51/260 (20%) | ||
WD40 repeat | 89..127 | CDD:293791 | 9/38 (24%) | ||
WD40 repeat | 130..166 | CDD:293791 | 7/41 (17%) | ||
WD40 repeat | 174..209 | CDD:293791 | 8/40 (20%) | ||
WD40 repeat | 215..251 | CDD:293791 | 10/40 (25%) | ||
WD40 repeat | 257..293 | CDD:293791 | 8/35 (23%) | ||
WD40 repeat | 299..323 | CDD:293791 | |||
B0280.9 | NP_498555.1 | WD40 | <66..424 | CDD:225201 | 50/255 (20%) |
WD40 repeat | 122..195 | CDD:293791 | 2/7 (29%) | ||
WD40 | 167..423 | CDD:295369 | 50/254 (20%) | ||
WD40 repeat | 168..207 | CDD:293791 | 4/20 (20%) | ||
WD40 repeat | 201..251 | CDD:293791 | 13/59 (22%) | ||
WD40 repeat | 258..296 | CDD:293791 | 7/39 (18%) | ||
WD40 repeat | 303..343 | CDD:293791 | 8/39 (21%) | ||
WD40 repeat | 350..388 | CDD:293791 | 10/37 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |