| Sequence 1: | NP_649969.1 | Gene: | CG3909 / 41226 | FlyBaseID: | FBgn0027524 | Length: | 331 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_012825586.2 | Gene: | tep1 / 100485265 | XenbaseID: | XB-GENE-495387 | Length: | 2663 | Species: | Xenopus tropicalis |
| Alignment Length: | 315 | Identity: | 74/315 - (23%) |
|---|---|---|---|
| Similarity: | 135/315 - (42%) | Gaps: | 51/315 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 53 DFLVTGGLDDLVKVWDLQEDNTLKLRHKLKGHALGVVSVAVSSDGQTIASSSLDSTMCLWDARSG 117
Fly 118 D------------------KKHLLSFGP---------VDLW-------------TVQFSPCNKYV 142
Fly 143 ISGLNDGKISMYSVETGKAEQTLDAQNGKYTLSIAYSPDGKYIASGAIDGIITIFDVAAGKVVQT 207
Fly 208 LEGHA--MPVRSLCFSPNSQLLLTASDDGHMKLYDVTHSDVVGTLSGHASWVLCVAFSEDGKHFA 270
Fly 271 SSSSDNSVKIWDTSERK--CLHTFAEHTDQVWGVRYSPGNDKVASASEDKSLNIY 323 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3909 | NP_649969.1 | WD40 | 52..323 | CDD:238121 | 74/313 (24%) |
| WD40 | <54..326 | CDD:225201 | 73/314 (23%) | ||
| WD40 repeat | 89..127 | CDD:293791 | 10/55 (18%) | ||
| WD40 repeat | 130..166 | CDD:293791 | 12/48 (25%) | ||
| WD40 repeat | 174..209 | CDD:293791 | 7/34 (21%) | ||
| WD40 repeat | 215..251 | CDD:293791 | 12/35 (34%) | ||
| WD40 repeat | 257..293 | CDD:293791 | 10/37 (27%) | ||
| WD40 repeat | 299..323 | CDD:293791 | 8/23 (35%) | ||
| tep1 | XP_012825586.2 | TROVE | 309..634 | CDD:399034 | |
| DUF4062 | 1008..1116 | CDD:404200 | |||
| WD40 | 1803..2077 | CDD:238121 | 49/228 (21%) | ||
| WD40 repeat | 1803..1838 | CDD:293791 | |||
| WD40 repeat | 1843..1879 | CDD:293791 | 6/29 (21%) | ||
| WD40 repeat | 1885..1917 | CDD:293791 | 9/31 (29%) | ||
| WD40 repeat | 1922..1961 | CDD:293791 | 3/38 (8%) | ||
| WD40 | 1963..2293 | CDD:238121 | 55/201 (27%) | ||
| WD40 repeat | 1967..2002 | CDD:293791 | 11/34 (32%) | ||
| WD40 repeat | 2009..2044 | CDD:293791 | 7/34 (21%) | ||
| WD40 repeat | 2054..2089 | CDD:293791 | 12/34 (35%) | ||
| WD40 repeat | 2095..2132 | CDD:293791 | 10/37 (27%) | ||
| WD40 repeat | 2137..2178 | CDD:293791 | 8/25 (32%) | ||
| WD40 | 2176..2442 | CDD:238121 | |||
| WD40 repeat | 2185..2222 | CDD:293791 | |||
| WD40 repeat | 2229..2264 | CDD:293791 | |||
| WD40 repeat | 2270..2304 | CDD:293791 | |||
| WD40 repeat | 2311..2341 | CDD:293791 | |||
| WD40 | 2349..>2632 | CDD:421866 | |||
| WD40 repeat | 2359..2393 | CDD:293791 | |||
| WD40 repeat | 2400..2424 | CDD:293791 | |||
| WD40 repeat | 2464..2527 | CDD:293791 | |||
| WD40 repeat | 2537..2574 | CDD:293791 | |||
| WD40 repeat | 2589..2623 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||