DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3909 and apaf1

DIOPT Version :9

Sequence 1:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_012815297.2 Gene:apaf1 / 100127738 XenbaseID:XB-GENE-988968 Length:1248 Species:Xenopus tropicalis


Alignment Length:471 Identity:96/471 - (20%)
Similarity:162/471 - (34%) Gaps:166/471 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EENAHDSQLWACTWGRD-----TAASDPDDAV---------------VEPEENPFDFDKKEARPK 52
            |..|||.::..|.:..|     |.::|....:               :| :.|...|....:.| 
 Frog   652 EIEAHDDEVLCCAFSADEKLLATCSADRKVKIWNAKTGKPLRVYEEHIE-QVNCCQFTNGLSAP- 714

  Fly    53 DFLVTGGLDDLVKVWDLQED---NTLKLRHKLKGHALGVVSVAVSSDGQTIASSSLDSTMCLWDA 114
             .|.|...|.|:|:|:.:::   ||      |.||...|.....|.|.:.:||||:|.::.:||.
 Frog   715 -LLATCSNDCLIKLWNSEKNYCHNT------LIGHIESVYHCRYSPDDRYLASSSMDGSLKIWDV 772

  Fly   115 RSGDKKH---------------------------------------------------------- 121
            .|.:::.                                                          
 Frog   773 ESANEEKSIEVAKLFENEDEAQPEVLLKCCAWSNDGSRIMVTARNFLCIYDAERCNLLSQLKACH 837

  Fly   122 ----------------LLSFGPVDLW-------------------TVQFSPCNKYVISGLNDGKI 151
                            .||...|.||                   .|:|||.:...::..:|..:
 Frog   838 QILYCDFCTTNQIAALALSHYVVQLWDIDSSTKIADFNAHLSWVHCVKFSPKSSSFLTSSDDQTV 902

  Fly   152 SMYSVE----------------TGKAEQTLDAQNGK------------YTLS-----------IA 177
            .::...                |...|:||.....|            .|||           ..
 Frog   903 KLWETSNVSKPAATNLKREFDVTFSGERTLVLATSKDDCILLINGMTGETLSQIRAQDNCVTCCC 967

  Fly   178 YSPDGKYIASGAIDGIITIFDVAAGKVVQTLEGHAMPVRSLCFSPNSQLLLTASDDGHMKLYDVT 242
            .|.|.:..|.|..||.:.|.|::.|:::..|:||...|:...|:.:.:||:::|||..::::::.
 Frog   968 LSTDYQLAAIGHRDGKVKILDLSGGEILHKLDGHRDTVQHCQFTADGKLLVSSSDDCTVRVWNLV 1032

  Fly   243 HSDVVGTLSGHASWVLCVAFSEDGKHFASSSSDNSVKIWDTSERKCLHTFAEHTDQVWGVRYSPG 307
            ....: .|.||...|......::.|.| |.|.|.:||:|:....:.:..|..|:..|.....||.
 Frog  1033 SGKNL-ELCGHKEPVKFFKILQESKVF-SWSFDGTVKVWNLLTGQLIKEFICHSATVLACDISPD 1095

  Fly   308 NDKVASASEDKSLNIY 323
            :.|.:|||.|||..|:
 Frog  1096 STKFSSASTDKSAKIW 1111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3909NP_649969.1 WD40 52..323 CDD:238121 83/405 (20%)
WD40 <54..326 CDD:225201 84/405 (21%)
WD40 repeat 89..127 CDD:293791 12/111 (11%)
WD40 repeat 130..166 CDD:293791 10/70 (14%)
WD40 repeat 174..209 CDD:293791 11/45 (24%)
WD40 repeat 215..251 CDD:293791 7/35 (20%)
WD40 repeat 257..293 CDD:293791 9/35 (26%)
WD40 repeat 299..323 CDD:293791 10/23 (43%)
apaf1XP_012815297.2 DD 7..92 CDD:417479
NB-ARC 131..374 CDD:395745
APAF1_C 453..587 CDD:407760
WD40 610..906 CDD:238121 44/262 (17%)
WD40 repeat 619..655 CDD:293791 1/2 (50%)
WD40 repeat 660..697 CDD:293791 4/36 (11%)
WD40 repeat 703..741 CDD:293791 12/45 (27%)
WD40 repeat 746..788 CDD:293791 11/41 (27%)
WD40 repeat 800..875 CDD:293791 5/74 (7%)
WD40 871..1203 CDD:238121 57/243 (23%)
WD40 repeat 881..916 CDD:293791 5/34 (15%)
WD40 repeat 921..957 CDD:293791 8/35 (23%)
WD40 repeat 963..1000 CDD:293791 10/36 (28%)
WD40 repeat 1006..1041 CDD:293791 7/35 (20%)
WD40 repeat 1046..1080 CDD:293791 9/34 (26%)
WD40 repeat 1088..1123 CDD:293791 10/24 (42%)
WD40 repeat 1129..1170 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.