DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mical and WLIM2b

DIOPT Version :9

Sequence 1:NP_001247015.1 Gene:Mical / 41225 FlyBaseID:FBgn0053208 Length:4743 Species:Drosophila melanogaster
Sequence 2:NP_001190099.1 Gene:WLIM2b / 824743 AraportID:AT3G55770 Length:233 Species:Arabidopsis thaliana


Alignment Length:59 Identity:22/59 - (37%)
Similarity:36/59 - (61%) Gaps:4/59 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1095 EKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHF 1153
            :||:.|::|||.:|..:.:|:..|::|.||.||.:.|:|..|:    ..:|..||..||
plant     8 QKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYS----SMEGVLYCKPHF 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MicalNP_001247015.1 MDR <114..>160 CDD:302572
CH 563..>629 CDD:294029
LIM_Mical 1097..1153 CDD:188823 19/55 (35%)
Ehrlichia_rpt <2081..2479 CDD:118064
DUF3585 4592..4705 CDD:288945
WLIM2bNP_001190099.1 LIM1_SF3 6..68 CDD:188824 22/59 (37%)
LIM 108..202 CDD:295319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I4039
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2983
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.