powered by:
Protein Alignment Mical and WLIM2b
DIOPT Version :9
Sequence 1: | NP_001247015.1 |
Gene: | Mical / 41225 |
FlyBaseID: | FBgn0053208 |
Length: | 4743 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001190099.1 |
Gene: | WLIM2b / 824743 |
AraportID: | AT3G55770 |
Length: | 233 |
Species: | Arabidopsis thaliana |
Alignment Length: | 59 |
Identity: | 22/59 - (37%) |
Similarity: | 36/59 - (61%) |
Gaps: | 4/59 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 1095 EKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHF 1153
:||:.|::|||.:|..:.:|:..|::|.||.||.:.|:|..|: ..:|..||..||
plant 8 QKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYS----SMEGVLYCKPHF 62
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
56 |
1.000 |
Domainoid score |
I4039 |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1700 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm2983 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.810 |
|
Return to query results.
Submit another query.