DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mical and WLIM2a

DIOPT Version :10

Sequence 1:NP_001247015.1 Gene:Mical / 41225 FlyBaseID:FBgn0053208 Length:4743 Species:Drosophila melanogaster
Sequence 2:NP_181519.1 Gene:WLIM2a / 818577 AraportID:AT2G39900 Length:200 Species:Arabidopsis thaliana


Alignment Length:109 Identity:34/109 - (31%)
Similarity:51/109 - (46%) Gaps:19/109 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1095 EKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHFRLPPKP 1159
            :|||.|::|||.:|..:.:|:..|:.|.||.||.:.|:|..|:    ..:|..||..||      
plant     8 QKCRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYS----SMEGVVYCRPHF------ 62

  Fly  1160 LPQRTNKARKSAAAQPASPAVPPTAGSVPTAAATSEHMDTTPPR 1203
              ::..|...|.:....|||.|.|....|       .::.||.|
plant    63 --EQLFKESGSFSKNFQSPAKPLTDKPTP-------ELNRTPSR 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MicalNP_001247015.1 UbiH 128..>263 CDD:440419
CH_SF 567..669 CDD:469584
LIM_Mical 1097..1153 CDD:188823 20/55 (36%)
PRK10819 <1450..>1557 CDD:236768
bMERB_dom 4592..4705 CDD:463467
WLIM2aNP_181519.1 LIM1_SF3 6..68 CDD:188824 23/71 (32%)
LIM2_SF3 109..169 CDD:188825
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.