DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mical and CSRP3

DIOPT Version :9

Sequence 1:	NP_001247015.1	Gene:	Mical / 41225	FlyBaseID:	FBgn0053208	Length:	4743	Species:	Drosophila melanogaster
Sequence 2:	NP_003467.1	Gene:	CSRP3 / 8048	HGNCID:	2472	Length:	194	Species:	Homo sapiens

Alignment Length:	75	Identity:	23/75 - (30%)
Similarity:	32/75 - (42%)	Gaps:	7/75 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly  1075 TVIPKSSSKVALAFKKQAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFD 1139
            :|...:.||....|   ..||||..|.::||..||....|...|:.|.:|..|..:|.    :.:
Human   101 SVTTSNPSKFTAKF---GESEKCPRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLE----STN 158

  Fly  1140 RDDPQGRFYC 1149
            ..|..|..||
Human   159 VTDKDGELYC 168

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mical	NP_001247015.1	MDR	<114..>160	CDD:302572
		CH	563..>629	CDD:294029
		LIM_Mical	1097..1153	CDD:188823	16/53 (30%)
		Ehrlichia_rpt	<2081..2479	CDD:118064
		DUF3585	4592..4705	CDD:288945
CSRP3	NP_003467.1	Interaction with TCAP. /evidence=ECO:0000269\|PubMed:12507422	1..5
		LIM1_CRP3	9..62	CDD:188865
		Nuclear localization signal. /evidence=ECO:0000250\|UniProtKB:P50463, ECO:0000255	64..69
		Interaction with CLF2 and isoform 2. /evidence=ECO:0000269\|PubMed:19752190, ECO:0000269\|PubMed:24860983	94..105		1/3 (33%)
		LIM2_CRP3	120..173	CDD:188866	16/53 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910