powered by:
Protein Alignment Mical and CSRP3
DIOPT Version :9
Sequence 1: | NP_001247015.1 |
Gene: | Mical / 41225 |
FlyBaseID: | FBgn0053208 |
Length: | 4743 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_003467.1 |
Gene: | CSRP3 / 8048 |
HGNCID: | 2472 |
Length: | 194 |
Species: | Homo sapiens |
Alignment Length: | 75 |
Identity: | 23/75 - (30%) |
Similarity: | 32/75 - (42%) |
Gaps: | 7/75 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 1075 TVIPKSSSKVALAFKKQAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFD 1139
:|...:.||....| ..||||..|.::||..||....|...|:.|.:|..|..:|. :.:
Human 101 SVTTSNPSKFTAKF---GESEKCPRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLE----STN 158
Fly 1140 RDDPQGRFYC 1149
..|..|..||
Human 159 VTDKDGELYC 168
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.