DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mical and crip2l

DIOPT Version :9

Sequence 1:NP_001247015.1 Gene:Mical / 41225 FlyBaseID:FBgn0053208 Length:4743 Species:Drosophila melanogaster
Sequence 2:NP_001005968.1 Gene:crip2l / 449795 ZFINID:ZDB-GENE-041010-43 Length:202 Species:Danio rerio


Alignment Length:158 Identity:44/158 - (27%)
Similarity:61/158 - (38%) Gaps:41/158 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1094 SEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHFRLPPK 1158
            :.||..|::|||..||.|..|...|:.||||..|:..|..||:|    :..|:.||  |     |
Zfish     2 ASKCPKCEKTVYSAEKVTSLGKDWHKFCLKCERCNKTLNPGGHA----EHDGKPYC--H-----K 55

  Fly  1159 PL------PQRTNKARKSAAAQPASPAVPPTAGSVPTAAATSEHMDTTPPRDQVDLLETSRANAS 1217
            |.      |:..|.....:....    .|....|||.|      |:|.|..::   .:.:|....
Zfish    56 PCYAALYGPKGVNIGGAGSYVYD----TPVGDDSVPVA------METKPKTEE---KKATRGPVK 107

  Fly  1218 ADAMSDDEANVIDEHEWSGR-NFLPESN 1244
            |.:.|          .:||. |..|..|
Zfish   108 AASFS----------SFSGEPNICPRCN 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MicalNP_001247015.1 MDR <114..>160 CDD:302572
CH 563..>629 CDD:294029
LIM_Mical 1097..1153 CDD:188823 22/55 (40%)
Ehrlichia_rpt <2081..2479 CDD:118064
DUF3585 4592..4705 CDD:288945
crip2lNP_001005968.1 LIM1_TLP 5..58 CDD:188860 25/63 (40%)
LIM1_TLP 121..174 CDD:188860 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.