DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mical and Hil

DIOPT Version :9

Sequence 1:NP_001247015.1 Gene:Mical / 41225 FlyBaseID:FBgn0053208 Length:4743 Species:Drosophila melanogaster
Sequence 2:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster


Alignment Length:426 Identity:89/426 - (20%)
Similarity:145/426 - (34%) Gaps:125/426 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1097 CRFCKQTVYLMEKT--TVEGLVLHRNCLKCHHCHTNLRLGGY---AFDRDDPQGRFYCTQHFRLP 1156
            |..|.:|||.:::.  ..:....|..|.||.||.|.|.|..|   ...:||.:  .||:.|.   
  Fly    11 CLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKE--VYCSSHV--- 70

  Fly  1157 PKPLPQRTNKARKSAAAQPASPAVPPTAGSVPTAAATSEHMDTTPPRDQVDL---LETSRANASA 1218
            ||..|                                 .|:|.|    .|.:   |...|.|...
  Fly    71 PKSGP---------------------------------GHLDQT----SVGIRQALNAPRTNKFV 98

  Fly  1219 DAMSDDEANVIDEHEWSG-RNFLPESNNDSQSELSSSDESDTESDSEMFEEADDSPFGAQTLQLA 1282
            :.......:.:|.....| |...|  |.....|:||..::|::.....|:        |..|.:|
  Fly    99 NEQIRGTRSEVDGGPLGGSRQSTP--NGYGSREISSPSQNDSDYKYGRFD--------ASALHIA 153

  Fly  1283 ----SDWIGKQYCEDSDDSDDFYDSSEDDGKDDTEGEEFKKARELRRQEVRLQPLPANLPTDTET 1343
                ...|.|.|.:..:...|||.:.|:..  ..|.:..|:..:|.|:                 
  Fly   154 HALKQTEIQKAYNKAREKPIDFYLAREEQA--HLEMKHRKEEDDLYRK----------------- 199

  Fly  1344 EKLKLNVDNKENMADRSSLKSGNSFESARSQPSTPLSTPTRVEMEQLERNAPRKFSSEIEAISEK 1408
                                    |.|.|::....:....:.|.|:..:....||..|: |.|.:
  Fly   200 ------------------------FASKRAEEDRKIQDEFQDEWERELQRLTHKFEKEL-ATSRR 239

  Fly  1409 LYHMNNMVKMNKDLEVLAKENLVKSDILRKLTLKE----KWLA----ENAAIA---AGQKVTPTP 1462
            .....|::.|..:.:   ||:|.|:..||:...||    |.|.    |.||:.   :.:.:....
  Fly   240 SRDEANILTMRHEQQ---KEDLEKNMTLRRSKKKESITRKMLEHERYETAALVDRQSSEMLELIS 301

  Fly  1463 SATAPGLQPKSKF-DEKFEKVVSPPQ-PVVEPKPKP 1496
            :..:..:|.:|.| |::|.:...|.: |:..|.|.|
  Fly   302 ARRSEYMQSESIFLDDEFSEGAVPVEYPLNAPIPAP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MicalNP_001247015.1 MDR <114..>160 CDD:302572
CH 563..>629 CDD:294029
LIM_Mical 1097..1153 CDD:188823 19/60 (32%)
Ehrlichia_rpt <2081..2479 CDD:118064
DUF3585 4592..4705 CDD:288945
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 19/60 (32%)
BAR <147..>265 CDD:299863 30/164 (18%)
TGc 418..486 CDD:214673
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.