DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mical and Csrp2

DIOPT Version :9

Sequence 1:	NP_001247015.1	Gene:	Mical / 41225	FlyBaseID:	FBgn0053208	Length:	4743	Species:	Drosophila melanogaster
Sequence 2:	NP_803174.2	Gene:	Csrp2 / 29317	RGDID:	61950	Length:	193	Species:	Rattus norvegicus

Alignment Length:	118	Identity:	35/118 - (29%)
Similarity:	47/118 - (39%)	Gaps:	31/118 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly  1032 NLDVGERGRNKVASIAGQFGKKDEANSDEKNAGSSNATTNTNNTVIPKSSSKVALAFKKQAASEK 1096
            |:|.|||           .|.|.|      :|.....|||.|       :||.|   :|...:||
  Rat    81 NMDRGER-----------LGIKPE------SAQPHRPTTNPN-------TSKFA---QKYGGAEK 118

  Fly  1097 CRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYC 1149
            |..|..:||..||....|...|:||.:|..|..:|.    :....:.:|..||
  Rat   119 CSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLE----STTLTEKEGEIYC 167

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mical	NP_001247015.1	MDR	<114..>160	CDD:302572
		CH	563..>629	CDD:294029
		LIM_Mical	1097..1153	CDD:188823	16/53 (30%)
		Ehrlichia_rpt	<2081..2479	CDD:118064
		DUF3585	4592..4705	CDD:288945
Csrp2	NP_803174.2	LIM1_CRP2	9..63	CDD:188864
		Nuclear localization signal. /evidence=ECO:0000255	64..69
		LIM2_CRP2	119..172	CDD:188871	16/53 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1700
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810