DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mical and CRIP1

DIOPT Version :10

Sequence 1:NP_001247015.1 Gene:Mical / 41225 FlyBaseID:FBgn0053208 Length:4743 Species:Drosophila melanogaster
Sequence 2:NP_001302.1 Gene:CRIP1 / 1396 HGNCID:2360 Length:77 Species:Homo sapiens


Alignment Length:54 Identity:22/54 - (40%)
Similarity:28/54 - (51%) Gaps:4/54 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1096 KCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYC 1149
            ||..|.:.||..|:.|..|...||.||||..|...|..||:|    :.:|:.||
Human     3 KCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHA----EHEGKPYC 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MicalNP_001247015.1 UbiH 128..>263 CDD:440419
CH_SF 567..669 CDD:469584
LIM_Mical 1097..1153 CDD:188823 21/53 (40%)
PRK10819 <1450..>1557 CDD:236768
bMERB_dom 4592..4705 CDD:463467
CRIP1NP_001302.1 LIM_CRIP 4..57 CDD:188862 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.