DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn85F and CCP3

DIOPT Version :10

Sequence 1:NP_649965.2 Gene:Spn85F / 41221 FlyBaseID:FBgn0037772 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_180096.3 Gene:CCP3 / 817062 AraportID:AT2G25240 Length:385 Species:Arabidopsis thaliana


Alignment Length:161 Identity:39/161 - (24%)
Similarity:66/161 - (40%) Gaps:23/161 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NDLTHRLLHY--HSILNRNNFAFSPTALVSVLVALFEGSAGNTAEELRHVLQLPNNRDVTRVGYR 133
            ||:..||..:  .::.|.:|..|||.::..:|..:..||...|.|::...|.||:...:..|..:
plant    11 NDVVVRLTKHVIATVANGSNLVFSPISINVLLSLIAAGSCSVTKEQILSFLMLPSTDHLNLVLAQ 75

  Fly   134 DIHRRLRTYFFGSDNPLKGLSLNKGNVTVLKDFETVLMF-------YGYDLSVDMLSSTPANLTS 191
            .|..       |::.....||:..| |.:.|.|...|.|       |....|....:|.|:.:..
plant    76 IIDG-------GTEKSDLRLSIANG-VWIDKFFSLKLSFKDLLENSYKATCSQVDFASKPSEVID 132

  Fly   192 DAELVNTTMASNTTTMEMDAETTTSKDAEST 222
            :   |||....:|..:   .:...|:|:..|
plant   133 E---VNTWAEVHTNGL---IKQILSRDSIDT 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn85FNP_649965.2 serpin 72..>174 CDD:476815 27/110 (25%)
Serpin <450..634 CDD:459662
CCP3NP_180096.3 serpinP_plants 8..382 CDD:381001 39/161 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.