DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn85F and Spn27A

DIOPT Version :10

Sequence 1:NP_649965.2 Gene:Spn85F / 41221 FlyBaseID:FBgn0037772 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_652024.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster


Alignment Length:209 Identity:45/209 - (21%)
Similarity:82/209 - (39%) Gaps:40/209 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 FYLGNQQVVHTTFKVYNAVLYYKYFEHLKMSVLELELDTPEYNLMILLP----DYHTDIVAAAAS 510
            |:..........|.......||...|.||..:|.|.. ..:.:|.:|||    ..| |:|.    
  Fly   251 FFRSKDDQSRAEFMEQTDYFYYTTSEKLKAQILRLPY-KGKNSLFVLLPYALNGIH-DLVK---- 309

  Fly   511 LKLGPTLRLMRKQLK-PRW------VQAIIPDFKLHGTMFLTNDLQNMGICDVFEPNRADFRPMT 568
                   .|...:|| .:|      |:..:|.|.......|...|:::|:.::|| :.|....:|
  Fly   310 -------NLENDELKSAQWAMEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFE-DSASLPGLT 366

  Fly   569 EEKG------VYVRHIEQSIDVTIR-------THPINQLKRNYGAQSKPIQISVNHPFLFFIVDR 620
              :|      |.|.:|.|...:.:.       ...:.:::..:|..:...:.:||.||:|||.:.
  Fly   367 --RGADVAGKVKVSNILQKAGINVNEKGTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEE 429

  Fly   621 DLDVAVMSGRILNP 634
            .....:.:|::.:|
  Fly   430 STGNILFAGKVHSP 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn85FNP_649965.2 serpin 72..>174 CDD:476815
Serpin <450..634 CDD:459662 44/207 (21%)
Spn27ANP_652024.1 serpinK_insect_SRPN2-like 64..443 CDD:381044 44/207 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.