DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and Prmt6

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_849222.3 Gene:Prmt6 / 99890 MGIID:2139971 Length:378 Species:Mus musculus


Alignment Length:335 Identity:125/335 - (37%)
Similarity:172/335 - (51%) Gaps:52/335 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RPKSVFSQRTEESSASQYFQFYGYLSQQQNMMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGSG 191
            ||:     ||:......|::.|..:|..:.|:.|.|||..|:..||.|....:.|.|||||||:|
Mouse    38 RPR-----RTKSERDQLYYECYSDVSVHEEMIADQVRTEAYRLGILKNWAALRGKTVLDVGAGTG 97

  Fly   192 ILSFFAVQAGAAKVYAIEASNMAQYAQQLVESNNVQHKISVIPGKIEEIELPEKVDVIISEPMGY 256
            |||.|..||||.:|||:|||.:.|.|:::|..|.::.::.|:||.:|.:||||:||.|:||.|||
Mouse    98 ILSIFCAQAGARRVYAVEASAIWQQAREVVRLNGLEDRVHVLPGPVETVELPERVDAIVSEWMGY 162

  Fly   257 MLYNERMLETYLHAR-KWLKPQGKMYPTHGDLHIAPFSDESLYSEQYNKANFWYQSAFH-GVDLT 319
            .|.:|.||.:.|||| ||||..|.:.|...:|.:||.||:.|..    :..||.|...| |||::
Mouse   163 GLLHESMLSSVLHARTKWLKEGGLLLPASAELFVAPISDQMLEW----RLGFWSQVKQHYGVDMS 223

  Fly   320 TLHKEGMKEYFRQPIVDTFDIRICMAKSVRHVCDFLNDKED---------DLHLISIPLEFHILQ 375
            .:              ::|..|..|..|...|.|.  ..||         .|.|....|| ..|:
Mouse   224 CM--------------ESFATRCLMGHSEIVVQDL--SGEDVLARPQRFAQLELARAGLE-QELE 271

  Fly   376 TGI-------C------HGLAFWFDVEFSG--SSQNVWLSTSPTAPLTHWYQVRCLLPMPIFIKQ 425
            .|:       |      ||.|.||.|.|.|  |.:.:.|||||..|.|||.|....|..|:.::|
Mouse   272 AGVGGRFRCSCYGSAPLHGFAVWFQVTFPGGDSEKPLVLSTSPFHPATHWKQALLYLNEPVPVEQ 336

  Fly   426 GQTLTGRVLL 435
            ...::|.:.|
Mouse   337 DTDISGEITL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622 2/6 (33%)
PRMT5 53..430 CDD:282971 123/328 (38%)
AdoMet_MTases 183..281 CDD:100107 55/98 (56%)
Prmt6NP_849222.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 4/12 (33%)
Methyltransf_18 85..188 CDD:289607 56/102 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.