DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and OMS1

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_010602.3 Gene:OMS1 / 851911 SGDID:S000002724 Length:471 Species:Saccharomyces cerevisiae


Alignment Length:379 Identity:61/379 - (16%)
Similarity:126/379 - (33%) Gaps:125/379 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ADEQKLEFTNKYKGSCTLLCSYDSQGVVLRVVSDDDRS--------HVLKEYMIAADTDAAQMGR 91
            :..:.|.||: ||        |:|..:      |||:|        .:....:|.......::.:
Yeast    27 SQRRSLSFTS-YK--------YNSSHI------DDDKSKKKLKNVFQMNSNRVIRKQKTKEELAK 76

  Fly    92 RSYAVSLDADNLVLR------------------------------------FASEQD-QQLFRKV 119
            ..:...|.:.|..:|                                    ||.::: ::|.:|.
Yeast    77 ERFEEQLRSPNRFVRWGAIARSEKFSKGMTKYMIGAYVIFLIYGLFFTKKLFAKDKELERLLKKQ 141

  Fly   120 VE---------NVKHLRPKSVFSQRTEESSASQY----------FQFYGYLSQQQNMMQDYV--- 162
            .|         .:|.|:.|   .:|.:|....:|          |......:..||.:.:.:   
Yeast   142 EEGNANEYEALRIKELKGK---LRRRDELKLEEYKKMQEEGIENFDDIRVQNFDQNKLNEQILPA 203

  Fly   163 --RTSTYQRAI--LGNAVDFQDKI-----------------VLDVGAGSG-ILSFFAVQAGAAKV 205
              .|:.||...  ...|::.::::                 ||:|..|:| .:.:..:....:..
Yeast   204 RDTTNFYQEKANEYDKAINMEERVIFLGKRRKWLMKHCQGDVLEVSCGTGRNIKYLDMSRINSIT 268

  Fly   206 YAIEASNMAQYAQQLVESNNVQH-KISVIPGKIEE-IELPE--------------KVDVIISEPM 254
            :...:.||.:...:.......:: |::.:.||.|. ::|.|              |.|.|: |..
Yeast   269 FLDSSENMMEITHKKFREKFPKYKKVAFVVGKAENLVDLAEKGKPSLENEKENQVKYDTIV-EAF 332

  Fly   255 GYMLYNERMLETYLHARKWLKPQGKMYPTHGDLHIAPFSDESLYSEQYNKANFW 308
            | :..:|..::...:..|.|||.|::...........|.::.|.:....:.|.|
Yeast   333 G-LCSHEDPVKALNNFGKLLKPDGRIILLEHGRGQYDFINKILDNRAERRLNTW 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622 23/152 (15%)
PRMT5 53..430 CDD:282971 56/361 (16%)
AdoMet_MTases 183..281 CDD:100107 24/114 (21%)
OMS1NP_010602.3 Methyltransf_25 245..355 CDD:404528 23/111 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.