DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and PRMT11

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_194680.1 Gene:PRMT11 / 829072 AraportID:AT4G29510 Length:390 Species:Arabidopsis thaliana


Alignment Length:361 Identity:134/361 - (37%)
Similarity:192/361 - (53%) Gaps:23/361 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NLVLRFA-SEQDQQLFRKVVENVKHLRPKSVF----SQRTEE-----SSASQYFQFYGYLSQQQN 156
            |..:||. :::|:......|...:..:.:|:|    |..|.|     :||..||..|.:....:.
plant    20 NTKIRFEDADEDEVAEGSGVAGEETPQDESMFDAGESADTAEVTDDTTSADYYFDSYSHFGIHEE 84

  Fly   157 MMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGSGILSFFAVQAGAAKVYAIEASNMAQYAQQLV 221
            |::|.|||.|||..|..|....:||||||||||:||||.|..:||||.|||:|.|.||..|:::|
plant    85 MLKDVVRTKTYQNVIYQNKFLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADMAKEIV 149

  Fly   222 ESNNVQHKISVIPGKIEEIELP-EKVDVIISEPMGYMLYNERMLETYLHAR-KWLKPQGKMYPTH 284
            ::|.....|:|:.||||||||| .||||||||.|||.|..|.||::.|:|| |||...|.:.|..
plant   150 KANGFSDVITVLKGKIEEIELPTPKVDVIISEWMGYFLLFENMLDSVLYARDKWLVEGGVVLPDK 214

  Fly   285 GDLHIAPFSDESLYSEQYNKANFWYQSAFHGVDLTTLHKEGMKEYFRQPIVDTFD-IRICMAKSV 348
            ..||:....| |.|.|  :|..||  ::.:|.|::.:.|:.|.|    |:|||.| .:|.....:
plant   215 ASLHLTAIED-SEYKE--DKIEFW--NSVYGFDMSCIKKKAMME----PLVDTVDQNQIVTDSRL 270

  Fly   349 RHVCDFLNDKEDDLHLISIPLEFHILQTGICHGLAFWFDVEFSGSSQNVWLSTSPTAPLTHWYQV 413
            ....|.......|.. .:.|.:....:....|.|..:|||.|:...:.:..||.|.:..|||.|.
plant   271 LKTMDISKMSSGDAS-FTAPFKLVAQRNDYIHALVAYFDVSFTMCHKLLGFSTGPKSRATHWKQT 334

  Fly   414 RCLLPMPIFIKQGQTLTGRVLLEANRRQSYDVTIDL 449
            ...|...:.|.:|:|:||.:.:..|::...|:.|.|
plant   335 VLYLEDVLTICEGETITGTMSVSPNKKNPRDIDIKL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622 7/36 (19%)
PRMT5 53..430 CDD:282971 128/340 (38%)
AdoMet_MTases 183..281 CDD:100107 59/99 (60%)
PRMT11NP_194680.1 AdoMet_MTases 111..211 CDD:100107 59/99 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.