Sequence 1: | NP_001262445.1 | Gene: | Art4 / 41219 | FlyBaseID: | FBgn0037770 | Length: | 530 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006504585.1 | Gene: | Mettl27 / 79565 | MGIID: | 1933146 | Length: | 266 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 39/197 - (19%) |
---|---|---|---|
Similarity: | 75/197 - (38%) | Gaps: | 46/197 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 169 RAILGNAVDFQDKIVLDVGAGSGILSFFAVQAGAAKVYAIEAS-NMAQYAQQLVESNNVQHKIS- 231
Fly 232 ------------------VIPGKIEEIE-----LPEKVDVIISEPMGYMLYNERMLETYLHARKW 273
Fly 274 LKPQGKMYPTHGDLHIAPFSDESLYSEQYNKANFWYQSAFHGVDLTTLHKEGMKEYFRQPIVDTF 338
Fly 339 DI 340 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Art4 | NP_001262445.1 | PH-like | 24..134 | CDD:302622 | |
PRMT5 | 53..430 | CDD:282971 | 39/197 (20%) | ||
AdoMet_MTases | 183..281 | CDD:100107 | 23/122 (19%) | ||
Mettl27 | XP_006504585.1 | AdoMet_MTases | 31..>103 | CDD:388410 | 12/45 (27%) |
Methyltransf_25 | 71..161 | CDD:379312 | 19/96 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |