DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and ndufaf5

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001076363.1 Gene:ndufaf5 / 794020 ZFINID:ZDB-GENE-070410-110 Length:321 Species:Danio rerio


Alignment Length:259 Identity:50/259 - (19%)
Similarity:90/259 - (34%) Gaps:74/259 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 FASEQDQQLFRKVVENVKHLRPKSVFSQRTEESSASQYFQFYGYL-----SQQQNMMQDYVRTST 166
            |:|.|...:|.:.::.    |.|...|...:.|.       |.||     |:..:.:.|..||. 
Zfish    18 FSSRQGMNVFDRSMKR----RQKDWASSLLDSSK-------YDYLREEVGSRVADRVYDVARTF- 70

  Fly   167 YQRAILGNAVDFQDKIVLDVGAGSGILSFFAVQAGAAKVYAIEASNMA----------------- 214
                          .:.||||.|...::....:....:::..:.|:.:                 
Zfish    71 --------------PLALDVGCGRSHIAEHLSKEVVERLFLTDISSSSLRNRKTSDIPAQCVMAD 121

  Fly   215 -------QYAQQLVESNNVQHKISVIPGKIEEIELPEKVDVIISEPMGYMLYNERMLETYLHAR- 271
                   :....||.|:...|.|:.:||.:.:|....|.|.:.   :|.|:..|.:.|.....: 
Zfish   122 EEFLPFKENTFDLVLSSLSMHWINDLPGALRQIHQVLKPDGVF---IGAMVGGETLYELRCSLQL 183

  Fly   272 KWLKPQGKMYPTHGDLHIAPFSDESLYSEQYNKANFWYQSAFH----GVDLTTLHKEGMKEYFR 331
            ..|:.:|...|     ||:|      |:...:..|...|:.|:    .:|...::..||.|..|
Zfish   184 AELEREGGFAP-----HISP------YTAVTDLGNLLGQAGFNMLTVDIDEVQVNYPGMLEVMR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622 6/26 (23%)
PRMT5 53..430 CDD:282971 50/259 (19%)
AdoMet_MTases 183..281 CDD:100107 22/122 (18%)
ndufaf5NP_001076363.1 BioC 67..290 CDD:273953 37/199 (19%)
Methyltransf_11 74..165 CDD:285453 16/93 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.