DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and Mettl7b

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_082129.2 Gene:Mettl7b / 71664 MGIID:1918914 Length:244 Species:Mus musculus


Alignment Length:207 Identity:33/207 - (15%)
Similarity:78/207 - (37%) Gaps:56/207 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 YFQFYGYLSQQQNMMQDYVRTSTYQRAILGNAVDFQ----DKIVLDVGAGSGILSFFAVQAGAAK 204
            ||.::    ......:.|.:..:.:|.:.....|.:    :..:|::|.|:|  :.|.......|
Mouse    35 YFPYF----MAMLTARSYKKMESKKRELFSQIKDLKGTSGNVALLELGCGTG--ANFQFYPQGCK 93

  Fly   205 VYAIEAS-NMAQY-AQQLVESNNVQHKISVIP-GKIEEIELPEKVDVIIS--------------- 251
            |..::.: |..:: .:.:.|:.::|::..::. |:..:......:||::.               
Mouse    94 VTCVDPNPNFEKFLTKSMAENRHLQYERFIVAYGENMKQLADSSMDVVVCTLVLCSVQSPRKVLQ 158

  Fly   252 ------EPMGYMLYNERMLETYLHARKWLKPQGK--------MYPT--H-GD-LHIAPFSDESLY 298
                  .|.|.:.:.|.:.|          |||.        :.||  | || .|:...:.:.:.
Mouse   159 EVQRVLRPGGLLFFWEHVAE----------PQGSRAFLWQRVLEPTWKHIGDGCHLTRETWKDIE 213

  Fly   299 SEQYNKANFWYQ 310
            ..|:::....:|
Mouse   214 RAQFSEVQLEWQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622
PRMT5 53..430 CDD:282971 33/207 (16%)
AdoMet_MTases 183..281 CDD:100107 20/129 (16%)
Mettl7bNP_082129.2 SmtA 33..>192 CDD:223574 25/172 (15%)
Methyltransf_11 75..172 CDD:285453 15/98 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.