DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and Mettl7a1

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_081610.2 Gene:Mettl7a1 / 70152 MGIID:1916523 Length:244 Species:Mus musculus


Alignment Length:170 Identity:37/170 - (21%)
Similarity:71/170 - (41%) Gaps:31/170 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 STYQRAILGNAVDF---QDKI-VLDVGAGSGILSFFAVQAGAAKVYAIEAS-NMAQYA-QQLVES 223
            ::.:|.:..|..:|   ..|: :|:||.|:|  :.|.......:|..|:.: |..::. :.:.|:
Mouse    52 ASQKRELFSNLQEFAGPSGKLTLLEVGCGTG--ANFKFYPPGCRVTCIDPNPNFEKFLFKSVAEN 114

  Fly   224 NNVQHKISVIPGKIEEIELPE-KVDVIISEPMGYMLYN-ERMLETYLHARKWLKPQGKMYPTHGD 286
            ..:|.:..|:....:..::.: .|||::...:...:.| |::|......   |||.|..|...  
Mouse   115 RQLQFERFVVAAGEDMHQVTDGSVDVVVCTLVLCSVKNQEKILREVCRV---LKPGGAFYFME-- 174

  Fly   287 LHIAPFSDESLYSEQYNKANFWYQSA-------FHGVDLT 319
             |:|        .|:.....||.|..       |.|.:||
Mouse   175 -HVA--------DERSTWNYFWQQVLDPVWFLFFDGCNLT 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622
PRMT5 53..430 CDD:282971 37/170 (22%)
AdoMet_MTases 183..281 CDD:100107 22/101 (22%)
Mettl7a1NP_081610.2 SmtA 70..>187 CDD:223574 27/132 (20%)
Methyltransf_11 75..172 CDD:285453 22/101 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.